KEGG   Sordaria macrospora: SMAC_08567Help
Entry
SMAC_08567        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
smp  Sordaria macrospora
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:smp03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 274 aa AA seqDB search
MPGKKWDEEESEASAPGSPVLAPGRRRFDDEEGNESDVLDSWDAAEDSEVEREKAKKAAE
AKAKAEAEAAANKKSKAQRIAERQAERARQLAEDSDFEEETEAERRERLRREQKESDLKH
AEDLFAGIGISNDRKVVTKGTIVQIDPKDPNNTIDISTLALFNPTTKTQFETLRTTLGPM
IERLSPKPHYTLFLQEFAKQLAKDLKSDEIKKIASSLTALSNEKLKEEKAAEKGGKKSKA
AKTKTSLAGVGRGGAIAEAHDTYEDDGFGDDDFM
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcctggaaagaagtgggacgaggaagagtctgaggcttccgcccccggctcccccgtt
ctcgcccccggccgccgccgcttcgacgatgaggagggtaacgagagcgacgttctcgac
tcctgggacgccgccgaggactctgaggtagagcgcgagaaggcgaagaaggctgccgag
gccaaggccaaggctgaggccgaagccgccgctaacaagaaatccaaggcccagcgcatc
gccgagcgccaggccgagcgcgcccgccaactggccgaggattcggactttgaggaggag
accgaggccgagcgccgcgagcgcctccgccgcgagcagaaggagtcggaccttaagcac
gccgaggacctgttcgccggcatcggcatcagcaacgaccgcaaggtcgtcaccaagggc
accattgtgcagattgaccccaaggaccccaacaacaccatcgacatctcgaccctggcc
ttgttcaaccccaccaccaagacccagttcgagaccctccgcaccaccctcggccccatg
atcgagaggctctcgcccaagccgcactacaccctcttcctccaggagttcgccaagcag
ctcgccaaggacctcaagagcgacgagatcaagaagattgccagctccctgacggctctc
agcaacgagaagctcaaggaggagaaggctgccgagaagggcggcaagaagagcaaggct
gccaagaccaagacctcgctcgctggtgttggccgtggcggtgccattgccgaggctcac
gatacctacgaggatgatggtttcggagatgatgactttatgtga

DBGET integrated database retrieval system