KEGG   Sordaria macrospora: SMAC_08567Help
Entry
SMAC_08567        CDS       T01610                                 

Definition
(RefSeq) uncharacterized protein
  KO
K03245  translation initiation factor 3 subunit J
Organism
smp  Sordaria macrospora
Pathway
smp03013  RNA transport
Brite
KEGG Orthology (KO) [BR:smp00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SMAC_08567
Ribosome biogenesis [BR:smp03009]
 Eukaryotic Type
  Pre-40S particles
   Other pre-40S particles
    SMAC_08567
Translation factors [BR:smp03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    SMAC_08567
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF3_subunit Nop53 Rrn6
Motif
Other DBs
NCBI-GeneID: 10807239
NCBI-ProteinID: XP_003349721
UniProt: F7VMK5
Position
Unknown
AA seq 274 aa AA seqDB search
MPGKKWDEEESEASAPGSPVLAPGRRRFDDEEGNESDVLDSWDAAEDSEVEREKAKKAAE
AKAKAEAEAAANKKSKAQRIAERQAERARQLAEDSDFEEETEAERRERLRREQKESDLKH
AEDLFAGIGISNDRKVVTKGTIVQIDPKDPNNTIDISTLALFNPTTKTQFETLRTTLGPM
IERLSPKPHYTLFLQEFAKQLAKDLKSDEIKKIASSLTALSNEKLKEEKAAEKGGKKSKA
AKTKTSLAGVGRGGAIAEAHDTYEDDGFGDDDFM
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcctggaaagaagtgggacgaggaagagtctgaggcttccgcccccggctcccccgtt
ctcgcccccggccgccgccgcttcgacgatgaggagggtaacgagagcgacgttctcgac
tcctgggacgccgccgaggactctgaggtagagcgcgagaaggcgaagaaggctgccgag
gccaaggccaaggctgaggccgaagccgccgctaacaagaaatccaaggcccagcgcatc
gccgagcgccaggccgagcgcgcccgccaactggccgaggattcggactttgaggaggag
accgaggccgagcgccgcgagcgcctccgccgcgagcagaaggagtcggaccttaagcac
gccgaggacctgttcgccggcatcggcatcagcaacgaccgcaaggtcgtcaccaagggc
accattgtgcagattgaccccaaggaccccaacaacaccatcgacatctcgaccctggcc
ttgttcaaccccaccaccaagacccagttcgagaccctccgcaccaccctcggccccatg
atcgagaggctctcgcccaagccgcactacaccctcttcctccaggagttcgccaagcag
ctcgccaaggacctcaagagcgacgagatcaagaagattgccagctccctgacggctctc
agcaacgagaagctcaaggaggagaaggctgccgagaagggcggcaagaagagcaaggct
gccaagaccaagacctcgctcgctggtgttggccgtggcggtgccattgccgaggctcac
gatacctacgaggatgatggtttcggagatgatgactttatgtga

DBGET integrated database retrieval system