KEGG   Sordaria macrospora: SMAC_08750Help
Entry
SMAC_08750        CDS       T01610                                 

Definition
(RefSeq) hypothetical protein
Organism
smp  Sordaria macrospora
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 989 aa AA seqDB search
MDKDRIRNALAVAKKEEPERYGDLTPEKEENYASSPLQTLNMYIKNILEDDWKAPQKRIA
SRNRTFSVQFGPACADIFLYLGFTEEVDIASQDKFWVPPRLPISSFRTPQGSERAFLENV
RSEVQSFLAESPPRPDLPVVGASIDAREWLDKILISDWLRSHENRSPRNSEEAQYFRILG
ASEQSDEEVLKYAFLQQVNVDPANRDTYRAALANLAGYRSEEFQMYVFSLDESPVAPSGP
QIQGPLSDVDKAYMHFNLQPNTNGDARYFIGVYKTYREQSPGQLSSHRLALLQIGKDRDD
SDILAEVFNGEMDFNEACSLLESEPNYTLEIYAAVAREAVKSGIDHRLVTKVCETIADTM
RKENVVDDSGWAEFDTVLAELRAPDLPSPFNSQQGAQFEDTTEFMSLPVGLDNLRNTCYL
NSILQYFYSVTAVRNFVMMADQTPLEPTQEAMRALLDGLDPSELDPGRAYVGSEFCRELG
SLFRDIQGAGTRSVRPRQRLANAALLRPDRIRSEPLEGAVDNASKPISVEAPPLPPRSGA
DEQPKVTVDAVPEHSETDSNLSSQTLVNQTEDDPTFIVVDCNTGKGESTGDDITMTDEPA
PSTPVADSANTAIDRPRDLKLTVVELNEELDKPNVGSDQMDVDEVMGNAIDHLRAAFKVE
SLRNPNTPGPDPIKEAFFLDAELLTYTTIKDPAPNFHICISRSDGRNKNANPVIIPELLY
LDRFMHTDQIDSPLFKARQRSWNIGNRLQELMSRETKTKENEAAVPIPLITRNETSSDSL
LDSFIHVSDQDMEELEGYDVTSFLTPELDATVGKYTSLPRPESSQPDMMPEAPEPDQGER
DDLDPSEISNFITSVKAEAAWEQGQLLAEREKLFDGMQQYVYRLHAVVCHAGTTAAAGHY
WVWIYDFEENVWRKYNDTTVSAHPAEEVFEQLNTRGEPYYVAYVRAENVKDLVSIPRRQF
VGPPVVSSDEPTTVHAETVDRMDLDAQDA
NT seq 2970 nt NT seq  +upstreamnt  +downstreamnt
atggataaggacaggatcagaaacgcgttggcggttgccaaaaaggaagagccggaacgc
tacggcgacctaacaccggaaaaggaggaaaactatgccagttctcccttgcagaccctc
aacatgtatattaaaaacatactcgaggacgactggaaggccccgcaaaagcgcatcgcc
agccgcaacaggaccttctcagtccagtttggcccagcatgtgccgacatattcctctat
ctcggcttcacggaagaagtggatatcgcaagccaggacaaattctgggtaccccctcgg
cttcccatttcatcatttcgaacaccccagggctcagaacgtgctttcctcgagaatgtc
agaagcgaagtgcaaagctttttagcagagagccctccaaggccggacttgcccgtcgtg
ggagcatcgattgatgcgagggagtggctggacaagattctcatatcggactggcttcgc
agccacgagaaccggtcgccgcgaaactctgaagaggcccaatacttccgcatcttggga
gcatccgaacagtcggatgaggaggtgctcaagtatgccttcctccaacaggtgaatgtc
gatccggcgaacagggacacttacagggctgcgcttgccaatttggctggctacaggagt
gaagagttccagatgtacgtcttcagtctggatgagagtcctgtcgcccctagcggccct
caaattcaagggcctctttcagacgtcgataaagcatatatgcacttcaatctccaacca
aacacgaatggagacgcccgctactttatcggtgtttacaaaacttacagagagcagtca
cctggacagctgtctagtcacagactcgcccttctccaaatcggcaaagacagggacgat
tcggatatacttgccgaagtattcaatggggagatggatttcaacgaggcatgttcactt
ctggaatccgagccaaactacaccttggagatttacgctgcagttgcacgggaggccgtc
aagagcggcatcgatcacagattggtcaccaaagtctgtgagacgatcgcggataccatg
agaaaggagaatgtagtggacgatagcggttgggctgaatttgatacagtcttagcagaa
ctccgcgctccagatttaccctccccattcaactcgcaacaaggcgcccagttcgaggat
acgacagagtttatgtcacttcctgtcggccttgataaccttcgaaatacatgctatctc
aacagcatccttcagtatttctactcggtcacagccgtgaggaacttcgtcatgatggcg
gaccagacacctttggagccaacccaggaagctatgcgggctcttctagacggcctagac
ccatctgaacttgaccctggccgggcttacgtcggatctgaattttgtcgtgagctgggc
tccctgtttcgcgacattcagggcgccggaacacgctccgtgagacccaggcaacgtcta
gccaatgcagctttgctcaggcccgacaggatacggagtgagcctctagagggagccgtt
gacaacgcgtccaaaccgatctccgtggaggctcctccactgcctcccagatcaggtgcg
gacgaacaacctaaggttacggttgatgcggtaccagagcactcggagacggatagcaac
ctgagctcacagaccttggttaaccagactgaagatgacccgacatttattgttgtcgac
tgcaataccggcaaaggggaaagcacaggcgacgatatcactatgactgatgaacctgcc
ccgtctacccctgtcgctgattctgccaatactgcaatcgacaggcctagggatctgaaa
ttgacggtggtagagcttaatgaagagcttgacaagcctaatgtcggttccgaccagatg
gacgtcgatgaagtcatgggcaacgcaatcgaccatctccgggcagcgttcaaggttgaa
tcgctcaggaatccgaatacaccaggaccagacccgatcaaggaagccttttttctcgac
gctgaacttctaacctatacgaccatcaaggacccggctcccaatttccacatctgcatt
tcgaggtcggatggccgtaacaaaaacgccaatcctgttatcatccccgagctgctatac
ctcgatcgcttcatgcacaccgaccagatcgattcgccactattcaaggcccgtcaaaga
agctggaacattggaaacaggctccaagagctcatgtcccgtgaaaccaagactaaggag
aacgaggctgccgtcccgattcccttaataacacgtaatgagacaagttccgacagcctt
ctagactccttcattcacgttagcgatcaggacatggaggaactagaaggttacgatgtc
acatcgttcttgacacccgagctcgatgccactgtcgggaagtatactagcctgcccagg
cctgagtcatctcagccagacatgatgcctgaagcgccagagcctgatcagggagagcgt
gacgatctcgatccaagcgagatcagtaacttcatcacgagcgttaaagctgaagctgcc
tgggaacaggggcagctgctggccgagcgtgagaagctgtttgatggcatgcagcagtat
gtgtaccggcttcacgcagtcgtctgccacgccggaaccacggccgccgccggtcactac
tgggtctggatctacgacttcgaagagaacgtttggcgcaagtacaacgacaccacggta
tctgcccacccagccgaggaagtatttgaacagctcaacaccaggggtgagccatactac
gtggcctacgtgcgggcagaaaacgtcaaggaccttgtgagcattccgcgtcgtcagttc
gtgggaccaccggtggttagctctgatgagcccacgacggtgcacgccgagacggtcgac
aggatggacttggatgctcaggatgcttag

DBGET integrated database retrieval system