KEGG   Sordaria macrospora: SMAC_08750Help
Entry
SMAC_08750        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
smp  Sordaria macrospora
Brite
Enzymes [BR:smp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     SMAC_08750
Peptidases [BR:smp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SMAC_08750
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 989 aa AA seqDB search
MDKDRIRNALAVAKKEEPERYGDLTPEKEENYASSPLQTLNMYIKNILEDDWKAPQKRIA
SRNRTFSVQFGPACADIFLYLGFTEEVDIASQDKFWVPPRLPISSFRTPQGSERAFLENV
RSEVQSFLAESPPRPDLPVVGASIDAREWLDKILISDWLRSHENRSPRNSEEAQYFRILG
ASEQSDEEVLKYAFLQQVNVDPANRDTYRAALANLAGYRSEEFQMYVFSLDESPVAPSGP
QIQGPLSDVDKAYMHFNLQPNTNGDARYFIGVYKTYREQSPGQLSSHRLALLQIGKDRDD
SDILAEVFNGEMDFNEACSLLESEPNYTLEIYAAVAREAVKSGIDHRLVTKVCETIADTM
RKENVVDDSGWAEFDTVLAELRAPDLPSPFNSQQGAQFEDTTEFMSLPVGLDNLRNTCYL
NSILQYFYSVTAVRNFVMMADQTPLEPTQEAMRALLDGLDPSELDPGRAYVGSEFCRELG
SLFRDIQGAGTRSVRPRQRLANAALLRPDRIRSEPLEGAVDNASKPISVEAPPLPPRSGA
DEQPKVTVDAVPEHSETDSNLSSQTLVNQTEDDPTFIVVDCNTGKGESTGDDITMTDEPA
PSTPVADSANTAIDRPRDLKLTVVELNEELDKPNVGSDQMDVDEVMGNAIDHLRAAFKVE
SLRNPNTPGPDPIKEAFFLDAELLTYTTIKDPAPNFHICISRSDGRNKNANPVIIPELLY
LDRFMHTDQIDSPLFKARQRSWNIGNRLQELMSRETKTKENEAAVPIPLITRNETSSDSL
LDSFIHVSDQDMEELEGYDVTSFLTPELDATVGKYTSLPRPESSQPDMMPEAPEPDQGER
DDLDPSEISNFITSVKAEAAWEQGQLLAEREKLFDGMQQYVYRLHAVVCHAGTTAAAGHY
WVWIYDFEENVWRKYNDTTVSAHPAEEVFEQLNTRGEPYYVAYVRAENVKDLVSIPRRQF
VGPPVVSSDEPTTVHAETVDRMDLDAQDA
NT seq 2970 nt NT seq  +upstreamnt  +downstreamnt
atggataaggacaggatcagaaacgcgttggcggttgccaaaaaggaagagccggaacgc
tacggcgacctaacaccggaaaaggaggaaaactatgccagttctcccttgcagaccctc
aacatgtatattaaaaacatactcgaggacgactggaaggccccgcaaaagcgcatcgcc
agccgcaacaggaccttctcagtccagtttggcccagcatgtgccgacatattcctctat
ctcggcttcacggaagaagtggatatcgcaagccaggacaaattctgggtaccccctcgg
cttcccatttcatcatttcgaacaccccagggctcagaacgtgctttcctcgagaatgtc
agaagcgaagtgcaaagctttttagcagagagccctccaaggccggacttgcccgtcgtg
ggagcatcgattgatgcgagggagtggctggacaagattctcatatcggactggcttcgc
agccacgagaaccggtcgccgcgaaactctgaagaggcccaatacttccgcatcttggga
gcatccgaacagtcggatgaggaggtgctcaagtatgccttcctccaacaggtgaatgtc
gatccggcgaacagggacacttacagggctgcgcttgccaatttggctggctacaggagt
gaagagttccagatgtacgtcttcagtctggatgagagtcctgtcgcccctagcggccct
caaattcaagggcctctttcagacgtcgataaagcatatatgcacttcaatctccaacca
aacacgaatggagacgcccgctactttatcggtgtttacaaaacttacagagagcagtca
cctggacagctgtctagtcacagactcgcccttctccaaatcggcaaagacagggacgat
tcggatatacttgccgaagtattcaatggggagatggatttcaacgaggcatgttcactt
ctggaatccgagccaaactacaccttggagatttacgctgcagttgcacgggaggccgtc
aagagcggcatcgatcacagattggtcaccaaagtctgtgagacgatcgcggataccatg
agaaaggagaatgtagtggacgatagcggttgggctgaatttgatacagtcttagcagaa
ctccgcgctccagatttaccctccccattcaactcgcaacaaggcgcccagttcgaggat
acgacagagtttatgtcacttcctgtcggccttgataaccttcgaaatacatgctatctc
aacagcatccttcagtatttctactcggtcacagccgtgaggaacttcgtcatgatggcg
gaccagacacctttggagccaacccaggaagctatgcgggctcttctagacggcctagac
ccatctgaacttgaccctggccgggcttacgtcggatctgaattttgtcgtgagctgggc
tccctgtttcgcgacattcagggcgccggaacacgctccgtgagacccaggcaacgtcta
gccaatgcagctttgctcaggcccgacaggatacggagtgagcctctagagggagccgtt
gacaacgcgtccaaaccgatctccgtggaggctcctccactgcctcccagatcaggtgcg
gacgaacaacctaaggttacggttgatgcggtaccagagcactcggagacggatagcaac
ctgagctcacagaccttggttaaccagactgaagatgacccgacatttattgttgtcgac
tgcaataccggcaaaggggaaagcacaggcgacgatatcactatgactgatgaacctgcc
ccgtctacccctgtcgctgattctgccaatactgcaatcgacaggcctagggatctgaaa
ttgacggtggtagagcttaatgaagagcttgacaagcctaatgtcggttccgaccagatg
gacgtcgatgaagtcatgggcaacgcaatcgaccatctccgggcagcgttcaaggttgaa
tcgctcaggaatccgaatacaccaggaccagacccgatcaaggaagccttttttctcgac
gctgaacttctaacctatacgaccatcaaggacccggctcccaatttccacatctgcatt
tcgaggtcggatggccgtaacaaaaacgccaatcctgttatcatccccgagctgctatac
ctcgatcgcttcatgcacaccgaccagatcgattcgccactattcaaggcccgtcaaaga
agctggaacattggaaacaggctccaagagctcatgtcccgtgaaaccaagactaaggag
aacgaggctgccgtcccgattcccttaataacacgtaatgagacaagttccgacagcctt
ctagactccttcattcacgttagcgatcaggacatggaggaactagaaggttacgatgtc
acatcgttcttgacacccgagctcgatgccactgtcgggaagtatactagcctgcccagg
cctgagtcatctcagccagacatgatgcctgaagcgccagagcctgatcagggagagcgt
gacgatctcgatccaagcgagatcagtaacttcatcacgagcgttaaagctgaagctgcc
tgggaacaggggcagctgctggccgagcgtgagaagctgtttgatggcatgcagcagtat
gtgtaccggcttcacgcagtcgtctgccacgccggaaccacggccgccgccggtcactac
tgggtctggatctacgacttcgaagagaacgtttggcgcaagtacaacgacaccacggta
tctgcccacccagccgaggaagtatttgaacagctcaacaccaggggtgagccatactac
gtggcctacgtgcgggcagaaaacgtcaaggaccttgtgagcattccgcgtcgtcagttc
gtgggaccaccggtggttagctctgatgagcccacgacggtgcacgccgagacggtcgac
aggatggacttggatgctcaggatgcttag

DBGET integrated database retrieval system