KEGG   Sordaria macrospora: SMAC_08873Help
Entry
SMAC_08873        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
smp  Sordaria macrospora
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SMAC_08873
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SMAC_08873
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SMAC_08873
Enzymes [BR:smp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SMAC_08873
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 554 aa AA seqDB search
MSNGVATNGNGSQDQTHTPSQRYLSTRGEDSGLSFEDVVLKGLASDGGLYIPEEVPVVPE
SVWQSWKDLSFTDLAYNIISLYISPSEIPAEDLKDIINRSYATFRTPDVTPLVHLQGSIH
LLELFHGPTFAFKDVALQFLGNLFEYFLVRKNQGKEGRDRYHLTVVGATSGDTGSAAIYG
LRGKKDVSVFMLHPKGKVSPVQELQMTTVLDANVHNLAVTGNFDNCQDIVKALFADPEIN
STHKLGAVNSINWARILAQTVYYFYSYFSLARQSESFNIGDKVRFVVPSGNFGDILAGYF
AFRMGLPVDKLVIATNENDILDRFWKTGCYTKKPVSSSKAEGGLPEDGVKAHEDGVKETM
SPAMDILVSSNFERLLWFLAYQFASSAGMDDEWNKKQAGQEVSSWLKDLKEKGGFGPVYK
DVLESARRNFESERVSDEETLDTIKSLYQEVGYVLDPHTAVGVEAARRSVKRAGDNIPHI
SLSTAHPAKFSGAVTLSLKDEAGFDFEAKVLPQEFVGLDKKEKRVNDVANDWMAVRELVR
KQVDEELKARDDSA
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacggcgtcgcgaccaacggcaatggatcccaggatcaaactcataccccttcc
cagcgctacttgagcacgcgcggtgaggacagcggtctctccttcgaagacgtcgtcctc
aagggtctcgcctccgacggcggtctctacatccccgaagaggtgcctgtcgtgcccgag
tccgtatggcaaagctggaaggacctctccttcaccgacctcgcctacaacatcatctcc
ctctacatctccccttcagagatccccgccgaagacctcaaagacatcatcaaccgctcc
tacgccaccttccgcacccccgacgtcactcccctcgtccacctccagggcagcatacac
cttcttgagctgttccacggcccgaccttcgccttcaaggatgtcgccctccagttcctc
ggcaacctctttgagtacttcctcgtgcgcaagaaccagggcaaagagggaagggacagg
taccacttgaccgttgttggtgcgacaagcggtgacaccggttctgccgccatctacggt
ctgcgcggcaagaaggatgtctccgtcttcatgcttcaccccaagggcaaggtgagcccc
gtccaggagctccagatgaccactgtcctcgatgccaacgtccacaaccttgccgtcact
ggcaacttcgacaactgccaagacattgtcaaggccctcttcgccgaccccgagatcaac
tctacccacaagctcggcgccgtcaactccatcaactgggcccgtatccttgctcagact
gtctactacttttactcttacttctcccttgcccgtcagtccgaatccttcaacattggc
gacaaggttcgcttcgtcgttccctcgggcaacttcggcgacatcctcgccggctacttc
gctttccgcatgggtctccccgtcgacaagctcgtcatcgccaccaacgagaacgatatc
cttgaccgcttctggaagacaggctgctacaccaagaagcccgtcagcagctccaaggcc
gagggcggtcttcccgaggacggcgtcaaggcgcacgaggatggagtcaaggagaccatg
agccccgccatggacatccttgtatcgagcaactttgagcgcctgctgtggttcctcgcc
taccagttcgcctccagcgccggcatggacgacgagtggaacaagaagcaggccggtcag
gaggtcagctcctggctcaaggatctcaaggagaagggcggtttcggtcccgtctacaag
gacgttctcgagagcgcgcgccgcaacttcgagtccgagcgcgtcagcgacgaggagacc
ctcgacaccatcaagagcctgtaccaggaggtcggctacgtactggacccccacaccgcc
gtcggcgtcgaagccgccaggaggtcggtcaagcgcgccggtgataacatcccccacatt
tccctctcgacagcccaccccgccaagttctcgggcgccgtcactctttcgctcaaggac
gaggccgggttcgacttcgaggccaaggtgctaccgcaggagtttgtcggtctggacaag
aaggagaagcgcgtcaacgatgtggccaatgactggatggcagtgagggagctggtcagg
aaacaagtagatgaggagttgaaggcgcgggatgattctgcatag

DBGET integrated database retrieval system