KEGG   Sordaria macrospora: SMAC_09127Help
Entry
SMAC_09127        CDS       T01610                                 

Gene name
putative os2
Definition
(RefSeq) putative OS2 protein
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
smp  Sordaria macrospora
Pathway
smp04011  MAPK signaling pathway - yeast
smp04139  Mitophagy - yeast
smp04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:smp00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    SMAC_09127 (putative os2)
 Cellular Processes
  Transport and catabolism
   04139 Mitophagy - yeast
    SMAC_09127 (putative os2)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    SMAC_09127 (putative os2)
Enzymes [BR:smp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     SMAC_09127 (putative os2)
Protein kinases [BR:smp01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   SMAC_09127 (putative os2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kdo APH Kinase-like RIO1 FTA2
Motif
Other DBs
NCBI-GeneID: 10801270
NCBI-ProteinID: XP_003343998
UniProt: F7WBC1
Position
Unknown
AA seq 357 aa AA seqDB search
MAEFIRAQIFGTTFEITSRYSDLQPVGMGAFGLVCSAKDQLTNQNVAIKKIMKPFSTPVL
AKRTYRELKLLKHLRHENVISLSDIFISPLEDIYFVTELLGTDLHRLLTSRPLEKQFIQY
FLYQIMRGLKYVHSAGVVHRDLKPSNILVNENCDLKICDFGLARIQDPQMTGYVSTRYYR
APEIMLTWQKYDVEVDIWSAGCIFAEMLEGKPIFPGKDHVNQFSIITELLGTPPDDVINT
IASENTLRFVKSLPKRERQPLKNKFKNADPSAVDLLERMLVFDPKKRITATEALSHEYLA
PYHDPTDEPVSEEKFDWSFNDADLPVDTWKIMMYSEILDYHNVEASGQMEYSEDIVQ
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggccgaattcatccgcgcccagatcttcggaactacctttgagatcacctcgaggtac
tctgatctccagcccgttggtatgggagcttttggtctcgtctgctccgcgaaagaccag
ctcaccaaccagaatgtcgccatcaagaagatcatgaagcccttcagcacaccggttctc
gccaagcgtacataccgtgagctgaagcttctcaagcacttgaggcatgaaaacgtcatc
tctctgagcgatatcttcatctctcctcttgaggatatctacttcgttaccgagcttctc
ggaactgatctgcatagacttctcacttctaggcctcttgagaagcaattcattcagtac
ttcctgtaccagatcatgcgcggcctcaaatacgtccactccgcaggtgttgttcatcgt
gacttgaagcccagcaacatcctggtcaacgagaactgcgacttgaagatttgcgatttc
ggcctcgcgcgcatccaggatcctcagatgactggctatgtctctactcgttactaccgc
gcccccgagatcatgctcacttggcagaagtacgacgtcgaggtcgatatctggagtgcc
ggctgcattttcgccgagatgctcgagggcaagcccatcttccccggaaaggaccacgtc
aaccagttctccatcattaccgagcttctcggcactccaccagacgatgtcatcaacacc
atcgccagtgaaaacaccctgagattcgtcaagtccctccccaagcgcgagcgtcagccc
ctgaagaataagtttaagaacgccgatccctcagctgtcgacctcctcgagcgcatgctt
gtctttgaccccaagaagcggataactgccaccgaggccctgtcccacgagtaccttgcc
ccctaccacgatcccaccgacgagcctgtttccgaggagaagttcgattggagtttcaac
gacgccgatctcccggtggacacatggaagatcatgatgtactccgagatccttgactac
cacaatgtcgaagcctccgggcaaatggagtactccgaggacattgtgcaataa

DBGET integrated database retrieval system