KEGG   Sordaria macrospora: SMAC_09143Help
Entry
SMAC_09143        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
smp  Sordaria macrospora
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:smp00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 319 aa AA seqDB search
MAQEKTRDDSDSSSGSVVSPAANGTNTTKKEKKNKDKSSKKRSHPSGERRSSVSKPARDP
SDKPTDDSPSKKKKRKTSASTIAAAVPPTIAEEVSSSTSVTRSPSPVIDFDGLSRPSRGT
RERLEETEAQKQERLDKMKGAVRTLLECLGEDPDREGLLATPERYAKAMLDFTQGYQENV
RDIVNGAIFQEGHNEMVIVKDIEVFSMCEHHLVPFTGKMHIGYIPSNAVIGISKLPRIAD
LFARRLQIQERLTKEVANAIMEILKPQGVAVVMESSHLCMVMRGVKKTTSSTITSCVLGC
FESREKTRSEFLSLIGVNR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggcccaagagaagacacgcgacgactccgacagctcctcgggctccgtcgtttccccc
gctgccaatggcaccaacaccaccaagaaggagaagaagaacaaggacaagtccagcaag
aagcgctctcacccttccggcgagaggcgatccagcgtcagcaagccagcgcgcgaccca
tccgacaagcccaccgacgactctccctccaagaagaagaagagaaagacctctgcatct
accatcgccgccgccgttccccccacaatcgccgaagaagtctcatcctccacttccgtg
acccgctccccttcgcccgtcattgacttcgatggcctaagtcgcccttcgcggggcacg
cgcgagcgtctggaggagaccgaagcccagaagcaggagcgtttggacaagatgaagggc
gccgtccgcacccttctcgaatgcctcggcgaagaccccgaccgtgagggtctcctcgcc
acgcccgagcgttacgccaaggccatgctcgatttcacccagggctaccaggagaacgtg
cgcgacatcgtcaacggggccatcttccaggagggccataacgaaatggtgatcgtcaag
gacattgaggtctttagcatgtgcgagcaccacttggtgcccttcacgggcaagatgcat
atcggctacatccccagcaacgccgtaattggaattagcaagctgcctcgcattgccgac
ctgttcgcgcgcagactgcagatccaggagcgcttgaccaaggaggtggccaatgctatc
atggagatcctcaagccccagggtgtcgcggttgtcatggagagcagccacttgtgcatg
gttatgagaggtgtcaagaagaccacgagcagtaccattaccagctgcgtgttgggctgc
tttgagtcgagggagaagacgaggagcgagttcttgagcttgattggtgttaaccgttga

DBGET integrated database retrieval system