KEGG   Sordaria macrospora: SMAC_09567Help
Entry
SMAC_09567        CDS       T01610                                 

Definition
(RefSeq) hypothetical protein
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
smp  Sordaria macrospora
Pathway
Fatty acid biosynthesis
Aflatoxin biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SMAC_09567
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SMAC_09567
   00640 Propanoate metabolism
    SMAC_09567
  Lipid metabolism
   00061 Fatty acid biosynthesis
    SMAC_09567
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    SMAC_09567
Enzymes [BR:smp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     SMAC_09567
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     SMAC_09567
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2252 aa AA seqDB search
MADTTSSDAVVKASYAAKHNLAPHFIGGNRLENAPPSKVKDFVASHDGHTVITNVLIANN
GIAAVKEIRSVRKWAYETFGDERAIKFTVMATPEDLQANADYIRMADHYVEVPGGTNNHN
YANVELIVDIAERMDVHAVWAGWGHASENPKLPESLAASPKKIVFIGPPGSAMRSLGDKI
SSTIVAQHADVPCIPWSGTGVNEVTVDDNGIVTVPDDIYLKGCVNSWQEGLEKAREIGFP
VMIKASEGGGGKGIRKVLSEDNFESLYNAAASEIPGSPIFIMKLADSARHLEVQLLADQY
GNNISLFGRDCSVQRRHQKIIEEAPVTIAKPTTFKAMEDAAVRLGRLVGYVSAGTVEYLY
SHADDKFYFLELNPRLQVAMGIPLHRIRDIRLLYGVDPKTATEIDFEFKNPESEKTQRRP
TPKGHTTACRITSEDPGEGFKPSNGVLHDLNFRSSSNVWGYFSVGSAGGIHSFSDSQFGH
IFAYGENRAASRKHMVVALKELSIRGDFRTTVEYLIKLLETEAFEDNTITTGWLDELISN
KLTAERPDPILAVVCGAVTKAHIASEACMAEYRAGLEKGQVPSKDILRTVFPVDFIYEGY
RYKFTVTRSSADSYHLFINGSKCTVGVRALSDGGLLILLNGRSHNVYWKEEVAATRMSVD
SKTCLLEQENDPTQLRTPSPGKLVKYTVENGEHVSAGQTFAEVEVMKMYMPLIAQEDGIV
QLIKQPGATLEAGDILGILALDDPSRVKQAQPFLGQLPEFGAPVIVGQKPAQKFRLLYDT
LQNILMGYDNQIIMQQTLKDLVEVLRDPKLPYSEFTAQFSALHARMPQKLDAQLTQVLEK
ASSRSAEFPARNLSKVFQKFLDENLVSKSDAELLKTTLAPLTTVIDQYSEGQKVHELNVI
RDLLTSYVEVERLFSGRRLQDEEVILKLRDENKEDIKKVTQTVLSHSRVAAKNSLILAIL
DEYRPNKPNVGNVSKYLRPVLRKLAELESRQTAKVSLKAREILIQCALPSLEERTAQMEH
ILRSSVVESRYGETGWDHREPSLDIIKEVVDSKYTVFDVLTLFFAHEDPWVSLAALEVYV
RRAYRAYVLKKIEYHADDTDSPSFLSWDFSLRKLGHSEFGLPILSAAPSTPGTPVESSFK
RISSISDMSYLSHKTQDEPTRKGVIIPCKFLDDADELLSRALEKLPVLGARKKSSVIPDL
NEKRRPALQRLETFDELSAVVNVAVRDAEGRSDEEILKEILPLVQQHREDLVARRVRRIT
FVCGRNDGSYPGYFTFRGPEYVEDDSIRHSEPALAFQLELGRLSKFKIKPVFTENKNIHV
YEAIGKGVETDKRYFTRAVIRPGRLRDEIPTAEYLISEADRVINDIFDALEIIGNNNSDL
NHMFLNFTPVFQLQPEEVEHSLQGFLDRFGPRGWRLRVAQVEIRIICTDPNTGMPYPLRV
IITNTSGYVIQVELYAERKSEKGEWVFHSIGGTTKIGSMHLLPVNTPYPTKNWLQPKRYK
AHLMGTQYVYDFPELFRQAIQNSWAKAVQKNPALAEKQPPVGECIEFGELVLDDHDNLTE
VSREPGTNTCGMVGWLIRARTPEYPSGRKFIVVANDITFNIGSFGPKEDNFFYKCTELAR
KLGIPRIYLSANSGARLGLATELMPHFNVAWKDASKPEAGFEYLYLDDAAKKRFENSVIT
EEITEGDEKRHRIVTIVGAEDGLGVECLRGSGLIAGATSRAYNDIFTCTLVTCRSVGIGA
YLVRLGQRAVQIEGQPIILTGAPALNNLLGREVYTSNLQLGGTQIMYRNGVSHLTANDDF
AGVSKIVEWMSFVPDKRNNPVPISISVDTWDRDIVYTPPQKQPYDVRWMIGGREDENGFQ
PGLFDKDSFVETLGGWARTVVVGRARLGGIPMGVIAVETRSVENITPADPANPDSIEQVA
NEAGGVWYPNSAFKTAQAINDFNNGEQLPLMILANWRGFSGGQRDMYNEVLKYGSFIVDA
LVKFEQPVFIYIPPFGELRGGSWVVVDPTINPVAMEMYADVDARGGVLEPEGIIGIKYRK
DKQLETMARLDPVYAELKRQSTDANLPKEESDAIKKKMTEREQQLLPVYAQISLQFADLH
DRAGRMKAKGVIREILEWKNARRFFYWRKTQRGVILRRIISATTPGGALSKALTANSTKE
RARHLQLLQAWSGIEQFDTADREVAVWYEENRHEVGTKIDALKAEQITSEMRDLIRTASR
GSDDAAWKGVRDVLSVMPVEEREKVIKYLTTL
NT seq 6759 nt NT seq  +upstreamnt  +downstreamnt
atggcggacacgaccagcagcgacgccgtcgtcaaggcttcgtacgccgcgaagcacaac
ctggccccccatttcattggcggtaacaggcttgaaaatgcccctccctccaaggtcaag
gattttgtggcttcccacgacggccacactgtcattaccaacgtccttattgccaacaac
ggtattgctgccgtcaaggagatccgctcagtaaggaaatgggcctacgagacattcggc
gacgagcgcgccatcaagttcaccgttatggccacccccgaagatttgcaggccaatgcc
gactacatcaggatggctgatcactacgtcgaagtccccggcggcacaaataaccacaac
tacgccaatgtcgagcttatcgttgatattgccgagcgtatggatgtccacgctgtgtgg
gctggttggggccacgcctccgagaaccccaagcttcccgagtcccttgcggcttccccc
aagaagatcgtcttcatcggtcccccgggttctgccatgcgctctctcggtgacaagatt
tcctcgacgattgtcgcccagcacgccgacgttccttgtatcccttggtctggtaccggt
gtcaacgaggtcacggtcgacgacaacggcattgttacggttcccgatgacatttacctc
aagggctgtgtcaactcgtggcaggagggtctcgagaaggccagggagattggtttccca
gtaatgatcaaggcctccgagggtggtggtggcaagggtatccgcaaggtcctcagcgag
gacaacttcgagtcgctttacaatgctgccgctagcgaaattcccggctcgcccatcttc
atcatgaagctcgccgacagcgccaggcatttggaggtccagcttcttgccgatcagtat
ggcaacaacatctcgctcttcggcagagattgctctgttcagcgcagacaccagaagatt
atcgaagaggcccccgtaaccatcgccaagcccactacctttaaggccatggaggatgct
gctgtccgtcttggtcgtctcgtcggttacgtctcggccggtaccgtcgagtacctctac
tctcacgccgatgacaagttctacttccttgagttgaacccccgtctgcaggttgccatg
ggtattcccctccaccgcatccgcgacatcagacttctctacggagtcgaccccaagacc
gccaccgagatcgacttcgagttcaagaaccccgagtctgaaaagacccagcgcaggccc
acccccaagggccataccactgcctgccgtatcacctctgaggatcctggtgagggcttc
aagccctccaacggtgtgttgcacgatctcaacttccgttcgagctccaacgtctggggt
tacttctccgtcggttccgccggtggtattcacagtttctccgactcccagttcggtcac
attttcgcttatggtgagaaccgtgccgcttcgcgcaagcacatggttgtcgccctcaag
gaattgagcattcgcggtgacttccgtaccaccgtcgaatacctcatcaagcttttggag
actgaggctttcgaggacaacaccatcactaccggctggctcgatgagctcatctccaac
aagctcactgctgagcgtcccgatcccatcctggccgtcgtttgcggtgccgtcaccaag
gcccacattgccagtgaagcctgcatggccgagtaccgtgccggtctcgagaagggtcag
gtcccctccaaggatattctcaggactgtcttccccgttgacttcatttacgagggttac
cgctacaagttcactgtcaccaggtcgagcgctgatagctaccatctcttcatcaacggc
tccaagtgcaccgtcggcgtccgtgctctgagcgacggtggactcctcatccttctcaac
ggtcgcagtcacaacgtctactggaaggaagaggttgctgctacccgcatgtcggtcgat
agcaagacctgtctgctcgagcaggagaacgatcccactcagttgcgcaccccctctccc
ggtaagctcgtcaagtacaccgtcgagaacggcgagcacgtcagcgccggtcagaccttc
gctgaggttgaggtcatgaagatgtatatgcctctgattgcccaggaggacggtatcgtt
cagctcatcaagcagcccggagctaccctcgaggccggtgacatcctcggtatccttgct
ctcgatgatcctagccgtgtcaagcaggctcagcctttcctcggccagcttcccgagttc
ggtgctcctgttatcgtgggtcagaagcccgctcagaagttccgtcttctctatgacact
ctccagaacatcctcatgggttacgataaccagatcatcatgcagcagacactgaaggac
ctggttgaggttcttcgtgatcccaagctcccctacagcgagttcaccgctcagttctcg
gcccttcatgctcgcatgccccagaagctcgatgcccagctcactcaggtcctcgagaag
gcttcttcgcgctccgccgagttccctgcccgcaatctcagcaaggtcttccagaagttc
ctggacgagaacctcgtctccaagtctgacgctgagttgctgaagaccactctcgcgcct
ctcactactgtcatcgaccagtactccgagggccagaaggtccatgagctcaatgtcatc
cgtgatctccttacttcttacgtcgaggtcgagcgcctcttctccggccgtcgtctgcag
gacgaggaggtcatcctcaagctgcgtgacgagaacaaggaggacatcaagaaggtcacc
cagaccgttctctcccatagcagagttgccgccaagaactcgctcattctcgccattctg
gacgagtaccgccccaacaagcctaatgtcggcaatgtcagcaagtaccttcgccccgtc
cttcgcaagcttgccgagctcgagtctcgtcagactgccaaggtctccctcaaggcccgc
gagatcttgatccagtgcgccctgccctctctcgaggagagaaccgctcagatggagcac
attcttcgctcctctgttgtcgagtctcgctacggtgagactggctgggatcaccgtgag
cccagcttggacatcatcaaggaggttgtggactccaagtacaccgtcttcgatgtcctg
accctcttcttcgcccatgaggatccttgggtgtccctcgctgcccttgaggtctatgtt
cgccgcgcttaccgtgcttacgtcctcaagaagattgagtaccacgccgacgatactgat
tctccttcgttcttgtcctgggacttctccctgcgcaagcttggccactctgagtttggc
ctgcctatcctgtccgccgctccctccaccccgggcacccctgtggagagttccttcaag
cgcatcagctccatcagcgatatgtcttacctctcccacaagactcaggatgagccaacc
cgcaagggcgtgatcattccctgcaaattcttggatgatgcggatgagctcctcagcagg
gctcttgagaagctccctgttctcggtgcccgcaagaagagcagcgtgatccctgatctc
aacgagaagcgcagacctgctctccagcgcctggagacctttgacgagctttccgccgtc
gtcaatgttgccgttcgcgacgccgagggtcgcagcgatgaggagattcttaaggagatt
cttcctcttgtccaacagcacagggaagatttggttgcccgtcgggtccgtcgcatcacg
tttgtctgtggtcgcaacgatggctcataccctggttacttcaccttccgtggccccgag
tacgttgaggacgatagcatccgtcacagcgagccagctcttgcgttccagctcgagctc
ggacgtctctccaagttcaagatcaagcctgtcttcactgagaacaagaacattcatgtg
tacgaggcgattggcaagggtgtcgagactgacaagcgctacttcactcgcgctgtcatt
cgtcccggccgtctgagggatgagattcctactgccgagtacctcatctctgaggccgat
cgtgtcatcaacgacattttcgatgctcttgagatcatcggtaataacaactccgatctc
aaccacatgttcttgaacttcaccccggtcttccagcttcagcctgaggaggttgagcac
tctctccagggcttccttgaccgcttcggccctcgtggctggcgcctccgtgttgcccag
gtcgagattcgcatcatctgcaccgaccctaacactggcatgccttatcccctgcgtgtc
atcatcaccaacacctccggatatgtcatccaggtcgagctttacgccgagcgcaagtcc
gagaagggcgagtgggtgttccactccatcggtggcaccaccaagattggctccatgcac
ttgctgccggtcaacactccttaccccaccaagaactggctccagcctaagcgttacaag
gctcatctcatgggcactcagtacgtctatgacttccctgagctcttccgtcaggccatc
cagaacagctgggccaaggctgtccaaaagaaccccgctcttgccgagaagcagccccct
gttggcgagtgtatcgaattcggcgagcttgtgctcgatgaccacgacaacttgaccgag
gtctcccgtgagcctggtaccaacacttgcggcatggtcggctggctcatccgtgctaga
acccccgagtaccctagcggtcgcaagttcattgttgttgccaacgacatcaccttcaac
attggctctttcggtcccaaggaggacaacttcttctacaagtgcactgagcttgcccgt
aagctgggcattcctcgcatctacctgtccgccaactcgggtgcccgcttgggtcttgcc
accgagcttatgcctcacttcaacgttgcctggaaggacgccagcaagcctgaggctggc
ttcgagtacctctaccttgacgatgcggccaagaagcgcttcgagaacagcgttatcacc
gaggagatcactgaaggcgatgagaagcgccacaggattgtcacgatcgtcggtgctgag
gatggtcttggtgttgagtgcttgcgtggctctggtctcattgccggtgctaccagcagg
gcctacaacgacatcttcacttgcacgctcgtcacctgccgctccgttggtatcggtgct
taccttgtgcgtcttggtcagcgtgctgtccagattgagggccagcccatcattctcact
ggtgcccctgccctcaacaacctcttgggtcgcgaggtctacacctccaacctgcagctt
ggtggcactcagatcatgtaccgcaacggtgtctctcacttgactgccaacgatgacttc
gctggtgtctccaagatcgtcgagtggatgtcgttcgttcctgacaagcgcaacaacccc
gtgcctatcagcatcagcgttgacacttgggatcgtgacattgtctacaccccgccccag
aagcagccttacgacgtcaggtggatgattggcggcagggaggacgagaatggcttccag
cctggtctttttgacaaggactccttcgtcgagactctcggcggatgggcccgcactgtc
gtcgtcggtcgcgctcgcctcggcggtattcccatgggtgttatcgctgtcgagacccgc
tctgttgagaacatcactcctgccgaccccgctaaccctgactcgatcgagcaggttgct
aacgaggctggtggtgtctggtaccccaactctgccttcaagacggcccaggccattaac
gatttcaacaacggcgagcagcttccgctcatgatcctcgccaactggcgtggtttctct
ggtggtcagcgcgacatgtacaacgaggttctcaagtacggctccttcatcgtcgacgcc
ctcgtcaagttcgagcagcccgtcttcatctacattcctcccttcggcgagcttcgtggt
ggttcgtgggtcgtcgtcgatcccaccatcaaccctgtcgccatggagatgtatgctgat
gttgatgctcgcggtggtgttctcgagcctgaaggtatcattggtatcaagtatcgcaag
gacaagcagcttgagaccatggcccgtctcgaccccgtttatgccgaactcaagaggcag
agcaccgacgctaacctccccaaggaggagtctgatgcgatcaagaagaagatgactgag
cgcgagcagcagcttctgcccgtttatgctcagatcagcttgcagttcgctgatctccac
gatcgtgctggtcgcatgaaggccaagggtgtcattcgcgagatccttgagtggaagaac
gcccgccgcttcttttactggcgtaagactcaacgaggagtcatcctccgtcgtatcatc
tccgccactacccccggcggtgccctcagcaaggctctcactgctaactcgaccaaggag
cgcgctcgccacttgcagcttcttcaggcctggagcggcattgagcagttcgatactgct
gaccgtgaggttgccgtctggtacgaggagaaccgccacgaggtcggcaccaagattgat
gccctcaaggctgagcagatcacctcggagatgcgcgaccttatccgcaccgcttctagg
ggatccgatgacgccgcctggaagggtgtccgtgatgtgctgagcgttatgcctgttgag
gaaagggagaaggttatcaagtatcttactactctctaa

DBGET integrated database retrieval system