KEGG   Sordaria macrospora: SMAC_12598Help
Entry
SMAC_12598        CDS       T01610                                 

Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
smp  Sordaria macrospora
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smp00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SMAC_12598
Enzymes [BR:smp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     SMAC_12598
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 670 aa AA seqDB search
MDESPANGPQGRHRNKVDGISEKLVAQVAEWIQHEKTKRETRKTIKVLRRRKTPPIHVNG
EPTVSSPTRPRSDSISSDSSEVSLDRLQKILDDGMSALGLDQVPQLGPRLGRRRSRRSLK
APPARTASSDTEFFDGDVVVPSCDVFLDNSKTMSYSGGKAGNEDTPSLASRREEKEKQAW
LAFKNEIIKLAHTLRLKGWRRIPLNGGETISVERLSGALTNAVYVVSPPPESVLPPQEGK
RQPEKLLLRVYGPQVEHLIDREIELGVLKRLARKKIGPRLLGTFLNGRFEQYFNSTTLTP
ENLREPETSRQIAKRMRELHDGIELLEHEKDDGPGVWRNWDKWLDQAEKTAMYLDNQVAA
ELQKTTRQKETWKTRGFVCGVEWPVFRQMVQKYRKFLEDYYGSPNTIREKLVFAHNDTQY
GNILRIRPDDKKSPLLQPANEHKQLIVIDFEYAGANLAGLEFANHFSEWTYNYHDPVTPH
ICDTTKYPTLEQQRRFIKAYVDHQPKFPSAPGASTPSVTASGTGTLAPGMLQSTNSTNSI
VDFMLDARVPPGGWKEEDARREAESEKRIKELLEETRLWRIANSAQWVVWGIIQAKIPGL
TNGTKDVVTAPDGSVPDEELEAEEEADAFDYLGYSQERAFFFWADCVRLGLITEEELPAN
VRSRLKFVEQ
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggatgaatctccggcaaatggtccacaaggtcgccaccgtaacaaagtagacgggatc
agtgagaaactggtcgcccaagtagcggaatggattcagcatgaaaagaccaagagagaa
actaggaagactatcaaggttttgcggcgacgcaagacaccgcccatccatgtgaacggg
gagcctaccgtctcctcgccgactcgccctcgttcagattccatcagttcagactcgagc
gaagtttctttggatcgacttcagaagatcctcgatgacggcatgtctgccctcggcctt
gatcaggtcccgcaactgggcccccgtcttggacgcagacgatctaggagaagtctgaag
gcaccacctgcccgtacggcctcttccgacaccgagttctttgacggcgatgtcgttgtt
cccagctgtgacgtgtttcttgacaactcgaagaccatgagctattcgggtggtaaggcg
ggcaacgaggacacgccttcgctggccagccgtagggaagagaaggagaagcaggcttgg
ctcgcgttcaagaacgagatcatcaagctggcacacactcttaggttgaagggatggagg
cgcattccgctcaatggtggtgagaccatctctgttgaaagactcagcggagcgctgacg
aacgctgtgtatgtcgtgtcaccacctcctgagtctgttttgcctccgcaggagggtaag
agacagccggaaaaactcctgctcagagtttacggtccgcaagttgagcacttgatcgat
cgagaaatcgaattgggtgttctcaagcgtctggcgagaaagaagattggtcctcggttg
ctcggtaccttcctgaacggccgcttcgagcagtacttcaactccaccacgttgacgccg
gagaatcttcgcgagcccgaaacgtccagacaaatcgccaagcgcatgagggaactccat
gacggcattgagctccttgagcatgaaaaggatgacggcccgggtgtttggaggaattgg
gataagtggcttgatcaggctgagaagacggccatgtacctcgacaaccaggttgcggcc
gagcttcagaagacgactcgtcagaaggaaacttggaagactaggggtttcgtctgcggc
gtcgagtggcccgtcttcagacagatggttcagaagtaccgcaagttcctggaggactac
tacggcagccctaacacaatcagggaaaagctggtctttgcccacaatgatactcaatac
ggcaacatcctgcgcatccggcccgacgacaagaagtcgcctttgctgcagcccgccaac
gaacacaagcagttgatcgtcatcgatttcgagtatgccggcgcgaacttggccggcctg
gagtttgccaaccacttctccgaatggacctacaactatcacgaccctgtcacgccccac
atttgcgacaccaccaagtatccaaccctcgagcagcagcggcggttcatcaaggcctac
gtggaccaccagccgaagttcccttcggcacctggtgcatcaacaccatctgtaacggcc
tcaggcacgggcacccttgcgcccggcatgctacagagcaccaactcgacaaactccatc
gtggacttcatgttggacgcccgcgtgccaccaggcggatggaaagaagaggacgcccgt
cgcgaggccgagtcggagaagaggatcaaggaactcctggaagaaacgaggctctggcga
attgcgaacagcgctcaatgggttgtctggggcatcatccaggctaagattccgggactt
accaacgggaccaaggacgtagtgacagcaccggacggcagcgtgcctgacgaggagctg
gaagcggaagaggaagcggatgcgttcgactaccttggatactcgcaggagagggccttt
ttcttctgggcggattgcgtacgccttgggctcattacggaggaggagttgccggcgaat
gtccgttccagactgaagtttgttgagcagtga

DBGET integrated database retrieval system