KEGG   Sinorhizobium meliloti BL225C: SinmeB_0050Help
Entry
SinmeB_0050       CDS       T01884                                 

Definition
Ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:smq00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SinmeB_0050
Enzymes [BR:smq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SinmeB_0050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(53960..54859)
Genome map
AA seq 299 aa AA seqDB search
MITVFGSINMDLIATTARLPKPGETVAGTDFSTAAGGKGANQALAARRAGASVRMAGAVG
SDAFAEGALALLKEAGTDLDLTKTVGEPTGTAHIIVGGDGENVIVVVASANARVSGDDAA
NVVAQMSAGDTLMLQLEIPSASVEKALSEAKRRGIRSIINIAPLTPDAARLGRMADIVIA
NETEFELLAGKAGIAGAEREEAMNGLHAETRQTVIVTLGAEGVVAIHEGELHRAKGLTIE
PVDTVGAGDTFCGYLAAGLDAGLAFSEALRRAAIAGSLACLKPGAQPSIPLAAEVAARL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgatcactgtttttgggtccatcaacatggacctgattgccaccaccgcacgccttccg
aagcccggcgaaacggttgccggaacggacttttccactgcggcgggcggcaagggcgca
aaccaggcgctcgcggcgcgccgcgccggcgcctcggtgcgcatggcaggtgccgttggc
tccgacgcctttgccgagggcgcgctggcgctgctcaaggaggccggcaccgatctcgat
ctgacgaagaccgtcggcgagccgaccggaacggcgcacatcatcgtcggcggcgacggc
gaaaacgtcatcgtcgtggtcgccagcgccaatgcacgcgtaagcggggacgacgccgcg
aacgtggttgcgcagatgtcggccggcgacacgctgatgctgcagctcgaaattccctcc
gcctcggtggaaaaggcactctccgaagcaaaacggcggggcatccgatcgatcatcaac
atcgcgccgctgacgccggatgcggcgcgcctcggccgcatggccgatatcgtcattgcc
aacgagaccgagttcgagctgctcgccggcaaagcgggcatcgccggcgccgagcgggaa
gaggctatgaacgggcttcacgccgagacccgccagaccgtgatcgtaacccttggtgct
gagggcgtggtggcgattcacgaaggcgaactccaccgcgcgaaagggctcacgatcgag
cccgtcgatacggtcggtgccggagatacgttctgcggctatctcgccgccggcctcgac
gccggtctcgcattctccgaggcgctccgccgcgccgcgattgcgggatcgctcgcctgc
ctcaagcccggcgcgcagccctcgataccgcttgccgccgaggtcgccgcccggctctag

DBGET integrated database retrieval system