KEGG   Sinorhizobium meliloti BL225C: SinmeB_0199Help
Entry
SinmeB_0199       CDS       T01884                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SinmeB_0199
Enzymes [BR:smq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     SinmeB_0199
    3.5.1.-  
     SinmeB_0199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
230134..230733
Genome map
AA seq 199 aa AA seqDB search
MADEALIVIDMQNDFCPGGALAVEGGDEIVPAVNRLIDASPHVVLTQDWHPAGHSSFAST
HPGKAPFQTVAMPYGEQTLWPEHCVQGSAGADFHPSLRWTSAELVIRKGFRREIDSYSAF
FENDHRTPTGLAGYLRERGIRSVTLCGLATDFCVAFSALDAVAKGFSTSVVLGACRGIDL
NGSLAAMTLRMRDAGVRLI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgaagccctgatcgttatcgatatgcagaacgacttctgccccggcggcgct
ctcgcggtcgagggcggcgatgaaatcgtgcccgccgtcaatcgcctcatcgacgcgtcg
ccgcatgtcgtcctgacgcaggactggcacccggccggccattccagtttcgcctcgacg
catccgggcaaggctccgtttcagaccgtggcgatgccttacggagagcagacgctctgg
cccgagcattgcgtccaggggagcgccggtgccgattttcatccgtccctgcgatggacc
tcggcggagctcgtcatacgcaagggcttccgtcgcgagatcgacagttattccgccttt
ttcgaaaacgaccaccggaccccgaccgggcttgccggttacctgcgcgagcgcggcata
agaagcgtgacgctttgcggcctggctaccgatttctgcgttgccttctcggcactcgat
gcggtcgctaagggtttttcgacgtcggtggtgctcggcgcctgccgtggcatcgatctg
aacggctcgcttgcggccatgaccctgcgcatgcgcgatgccggcgtccggctgatctag

DBGET integrated database retrieval system