KEGG   Sinorhizobium meliloti BL225C: SinmeB_0830Help
Entry
SinmeB_0830       CDS       T01884                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SinmeB_0830
Enzymes [BR:smq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SinmeB_0830
Exosome [BR:smq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SinmeB_0830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(877207..878220)
Genome map
AA seq 337 aa AA seqDB search
MNDRTNLVDRITGHRRMRRNRKADWTRRLVRENRLTVDDLIWPIFVVPGSGIVEPIDAMP
GVNRMSVDKAVEAAKEAAGLGIPAIATFPNIDMALRDETGSDSLNADNLINQATRAIKKA
VPDIGIITDVALDPFTSHGHDGILRGGEIVNDETVEAIARAAVIQADAGSDIIAPSDMMD
GRIGAIREALDAAGHQNVGIMSYATKFASAFYGPYREAIGTGGLLKGDKKTYYIDPSNGT
EAIRDAALDVEEGADMLMVKPGLPYLDICWRMKEAFGLPVFAYQVSGEYAQIKAAAANGW
IDGERVMLETLLAFKRAGCDGILSYFAVDVARILAKR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacaggacaaatcttgtggacaggatcaccggacaccgccgcatgcgccgcaat
cgcaaggcggattggacgcgccggctggtccgggagaaccgcctgacggtggacgacctg
atctggccgatcttcgtcgtgcccggcagcggcatcgtcgagccgatcgatgcgatgccg
ggcgtcaaccgcatgagcgtcgacaaggcggtcgaggccgcgaaggaggcggccggcctc
ggcatcccggccatcgccaccttccccaatatcgacatggcgcttcgcgacgagaccgga
tccgacagcctcaacgccgacaatctgatcaatcaggcgacgcgggcgatcaagaaggcc
gtacccgacatcgggatcatcaccgatgtcgcgctcgacccgttcaccagccacgggcac
gacggcatcctgcggggcggcgagatcgtcaacgacgagacggtggaggcgatcgccagg
gcggcggtcattcaggccgacgccggctccgacatcatcgcgccctccgacatgatggac
gggcggatcggcgcgatccgcgaggcgctcgacgcggccggccaccagaatgtcggcatc
atgtcctatgcgacgaaattcgcctccgccttctatggcccttatcgagaggcgatcggc
accggcggcctgctcaagggcgacaagaagacctattacatcgatccgtcgaacggtacg
gaggcgatccgcgatgcggcactcgatgtggaggaaggcgcggacatgctgatggtgaag
cccggcctgccctatctcgatatctgctggcggatgaaggaagccttcggcctgccggtc
ttcgcgtatcaggtttccggcgaatacgcgcagatcaaggcagccgccgccaatggctgg
atcgatggcgagcgggtgatgctggagacgctgctcgccttcaagcgggcgggttgcgac
gggatcctcagctactttgccgtcgacgtggctcgaattctcgcgaaacgctga

DBGET integrated database retrieval system