KEGG   Sinorhizobium meliloti BL225C: SinmeB_1050Help
Entry
SinmeB_1050       CDS       T01884                                 

Definition
GTP cyclohydrolase 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:smq00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1096470..1097084)
Genome map
AA seq 204 aa AA seqDB search
MDAIVKNFPVLDDTGRPTQKEAEEAVRVLLRWAGEDPAREGLKDTPSRVAKAYREIFGGY
DLVAEDVLGRTFEEVSGYDDIVLEKDIPFYSHCEHHMVPIIGKAHIAYLPNGRVLGLSKI
ARVVDIYARRLQTQEAMTAQIAKAIDETLMPRGVAVMIEAEHLCMAMRGIKKQGATTLTT
TFTGAFKSEPAEQVRFMTMLRGFK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatagtgaagaattttcctgtgctcgacgacacaggtcgtccgacgcagaag
gaagccgaagaagccgttcgcgtcttgttgcgctgggcaggtgaagatccggcacgagaa
ggcctgaaggacacgccttcgcgtgtcgccaaggcgtatcgggaaattttcggcggctac
gatctcgtggcggaagacgtgctcgggcgaaccttcgaggaagtctccggctacgacgat
atcgtgctcgaaaaggacatcccgttctattcgcattgcgagcaccacatggtgccgatc
atcggcaaggcccatatcgcctatctgccgaacggccgcgtgctcggcctttccaagatc
gcccgggtcgtcgatatctacgcccgtcgcctgcagacgcaggaagcgatgacggcgcag
atcgcaaaggccatcgacgagaccctcatgccccggggcgtggcggtgatgatcgaggcc
gagcacctgtgcatggcgatgcgcggtatcaagaagcagggcgcgacgacgctgacgacc
accttcaccggtgcgttcaagagcgagccggccgaacaggtccgcttcatgacgatgctc
aggggcttcaagtaa

DBGET integrated database retrieval system