KEGG   Sinorhizobium meliloti BL225C: SinmeB_1157Help
Entry
SinmeB_1157       CDS       T01884                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smq00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SinmeB_1157
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SinmeB_1157
Enzymes [BR:smq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SinmeB_1157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1211709..1212743
Genome map
AA seq 344 aa AA seqDB search
MQYAFRMSESKAFISGCKGLTLTQEERDFFAGERPWGFILFGRNIGEEEQIRDLVASLRD
SIGSPRAPVLIDQEGGRVQRIRPPLVQQYPNGAAIGEIYRRDRELGLRAAWLMGRLHAFD
LMRFGITVDCLPVLDVPVPGSHDVIGNRAYGHDPATVTAIGRAMSEGLKAGGMLPVMKHM
PGHGRTFVDSHHNLPVVSAGLDELKSSDFLPFAAMKDEAMAMSAHMVFTAIDPDNPATTS
AKVVREIIRGHIGFDGLLMSDDVSMNALAGDMTARAGGIIAAGLDLVLHCHGIMEEMKAV
ADVVPVLSGERLRRARAAEAAFREPDDAVEAALRAEFNAMFALA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatgcttttcgcatgagcgaatcaaaagcattcatatccggctgcaagggcctc
acgctgacgcaggaagaacgcgacttctttgcgggcgagcgcccatggggcttcatactg
ttcggacgcaatatcggcgaggaagagcagatccgcgacctggtggcgagcctgcgtgac
agcatcggcagcccccgggccccggtattgatcgatcaggagggcggtcgcgttcagcgc
atacgcccgccgctcgtgcagcaatatccgaacggcgcggccatcggtgaaatctatcgg
cgggacagggaactcggcctgcgtgccgcatggctcatggggcgtctgcatgccttcgac
ctgatgcgcttcggcattacggtcgattgcctgccggtactcgatgtgccggtacccggc
agccatgacgtgatcggcaatcgtgcctacgggcatgacccggcgacggtaaccgcgatc
ggtcgcgcgatgagcgaaggtttgaaggcgggcggcatgctgccggtgatgaagcacatg
cccggtcacggccggaccttcgtcgactcgcatcacaacctgccggtcgtcagcgccggt
ctcgatgaattgaagagcagcgattttctgcccttcgcggcaatgaaggacgaagcgatg
gccatgtcggcgcacatggtcttcactgctatcgacccggacaacccggcgacgacctct
gcgaaagtcgtgcgcgagatcatccggggccacatcggcttcgacggtctgctgatgtcc
gatgacgtctccatgaatgcgcttgccggcgacatgacggcacgtgccggcggaataatc
gccgccggtcttgatctcgtcttgcattgtcacggcattatggaagaaatgaaggccgtg
gcagatgtcgttccggttctctccggggagaggctccgccgggcgagggctgccgaggcc
gctttccgggaaccggacgacgcagtcgaagctgcactgcgcgcggagttcaacgcaatg
tttgcgctcgcctag

DBGET integrated database retrieval system