KEGG   Sinorhizobium meliloti BL225C: SinmeB_1407Help
Entry
SinmeB_1407       CDS       T01884                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
smq01100  Metabolic pathways
smq01110  Biosynthesis of secondary metabolites
smq01130  Biosynthesis of antibiotics
smq01230  Biosynthesis of amino acids
Module
smq_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smq00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SinmeB_1407
Enzymes [BR:smq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SinmeB_1407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AEG04327
JGI: SinmeB_1407
UniProt: A0A0E0UCD8
Position
1468608..1469423
Genome map
AA seq 271 aa AA seqDB search
MTDILRRIEAYKREEIAAAKARVPLEELKARAADQSAPRGFHAALAARRDKGEFGLIAEI
KKASPSKGLIRPDFDPPELAKAYAAGGAACLSVLTDAPSFQGAPEFLTKAREACPLPALR
KDFMFDTYQVFEARAWGADCILLIMASLGDNDARRLEEAAFALGMDVLVEVHDAEEMERA
LRLSSPLVGINNRNLRTFEVDLAVSERLAAMVSADRLLVGESGVFTHEDCRRLEKSGITT
FLVGESLMRKDDVEAATRALLTGSASIMAAE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgacggatatcctgcgccgcatcgaagcctataagcgagaggagatcgccgccgcgaaa
gcgcgcgttccgctcgaagagttgaaggcgcgggccgccgatcagtccgcgccgcgcggt
ttccacgccgcgcttgcggcccggcgggacaaaggcgagttcgggctgatcgccgaaatc
aagaaggcgagcccctcgaagggtttgatccgcccggatttcgatcctccggaactggcg
aaggcctatgccgcgggcggcgccgcctgcctctccgtccttaccgacgcgccgagcttc
cagggtgcgccggagttcctgacgaaggcacgcgaggcctgcccgctcccggctctgcgc
aaggacttcatgttcgacacctatcaggttttcgaagcgcgcgcctggggcgccgattgc
attctgctgatcatggcctcgcttggcgacaatgatgcgcgccggctggaagaagccgca
tttgcactcggcatggatgtcctcgtcgaagtacacgacgcggaagagatggaacgagca
cttcgcctgtcatctccgctcgtcgggatcaacaaccgcaatctcaggacgttcgaggtc
gatctcgccgtctccgaaaggctcgcggcaatggtttccgcagaccgtctcctggtcggc
gaaagcggcgtattcacgcacgaagactgccggcgcctagagaagagcgggattaccacc
ttcctggtcggtgaaagcctgatgaggaaggacgacgtagaggcggcgacgcgtgcgctg
ctgaccggctcggcaagcatcatggcggcagagtga

DBGET integrated database retrieval system