KEGG   Sinorhizobium meliloti BL225C: SinmeB_2344Help
Entry
SinmeB_2344       CDS       T01884                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:smq00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SinmeB_2344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: AEG05243
JGI: SinmeB_2344
UniProt: A0A0E0UFL9
Position
2416635..2417021
Genome map
AA seq 128 aa AA seqDB search
MRIALAALSFSALSLCPVAGLAQEGDAEAGATVFKKCATCHVIDKDQNKVGPSLQGVIGR
TAGTHADFKYSQAMIDAGKGGLVWDDATLAEYLRNPRAKVKGTKMVFPGLKKDEEIANVI
AYLKQHPK
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattgcacttgctgccctgtctttttcggcactctcgctctgtccggtcgccggg
ctcgcccaggagggcgatgccgaggccggcgccaccgtcttcaagaaatgcgccacctgt
cacgtgatcgacaaggaccagaacaaggtcggcccttcgctgcaaggcgtcatcggccgg
acggccggcacccatgctgacttcaaatattcgcaagccatgattgatgcgggcaagggt
ggcctcgtctgggacgacgcgacgctggccgaatatctccgtaatcccagggccaaggtc
aaaggcaccaagatggtattccccggcctcaagaaggacgaggagattgccaatgtgatc
gcctacctgaagcagcatcccaaatag

DBGET integrated database retrieval system