KEGG   Sinorhizobium meliloti BL225C: SinmeB_2462Help
Entry
SinmeB_2462       CDS       T01884                                 

Definition
(GenBank) Acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq00010  Glycolysis / Gluconeogenesis
smq00620  Pyruvate metabolism
smq00640  Propanoate metabolism
smq00680  Methane metabolism
smq01100  Metabolic pathways
smq01110  Biosynthesis of secondary metabolites
smq01120  Microbial metabolism in diverse environments
smq01130  Biosynthesis of antibiotics
smq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SinmeB_2462
   00620 Pyruvate metabolism
    SinmeB_2462
   00640 Propanoate metabolism
    SinmeB_2462
  Energy metabolism
   00680 Methane metabolism
    SinmeB_2462
Enzymes [BR:smq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SinmeB_2462
Lipid biosynthesis proteins [BR:smq01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SinmeB_2462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEG05359
JGI: SinmeB_2462
UniProt: A0A0E0UF68
Position
complement(2551558..2553204)
Genome map
AA seq 548 aa AA seqDB search
MLPKIEDYDELYREFRWRIPERFNIGVAVSDAWAARDPERICLQHFSPDGAHLALTYGDF
AARSSAFAGGLAAHDVSPGERVAILLPQGFEAAIAHAAIYKLGAIALPLALLFGVEALAY
RLKDAGAAAVVTNRFGYERLAAIRGELPELRMVVLAEEDEKPGTVRFRDIAAGQGRFDPA
ETKPDDPALMIYTSGTTGPPKGALHGHRVLLGHLPGFQFHHHFLPQPGDRMWTPADWAWA
GGLLNALLPSLFFGVPVVSSPAQKFDAHTAFRIIEEMEVRNAFIPPTALRLLKSVERPRD
RCALKLRTVGSAGEALGRETFEWARAALGVEVSEFYGQTECNIVISSATGLGVAKAGSMG
KAAPGHQVAIIDGEGRVLPPGTVGQVAIRRPDPVMFLGYWRNEEATEAKFIGDWMTTGDQ
GVMDEEGYFTFFGRDDDVITSSGYRIGPSEIEDCLAGHPDVQLAAAVGKPDPLRTEIVKA
YVVLKPGVAAGDETAAGIRDWVKNRLSMHEYPREIAFVDSLPLTTSGKVIRRLLREKAAA
EARAASGG
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgctcccgaagatcgaagactacgacgaactctatcgcgaattccgctggcggatccct
gagaggttcaatatcggcgtggccgtgagcgacgcctgggccgcgcgtgatccggagcgc
atctgtcttcagcatttcagcccggacggcgcgcatcttgcgctgacctatggcgacttc
gccgcgcgttcgtccgcctttgccggcgggcttgccgcgcatgacgtgagccccggcgaa
cgcgtcgccatcctgctgccgcagggtttcgaggcggcgatcgcccatgcggcgatctat
aaactcggcgccatcgcgctgccgctggcactgctcttcggcgtcgaggcgcttgcctat
cggctgaaggatgcgggcgcggcagcagtcgtcaccaatcgcttcggctatgagcggctt
gcggcgatccgcggcgagctgccggaacttcgtatggtcgtcctggccgaggaggacgag
aagcccggcacggttcgtttccgcgatatcgcggcagggcagggccgcttcgaccccgcg
gagacgaagccggacgatccggcgctgatgatctacacctcgggaacgaccggaccgccg
aagggggccttgcacgggcaccgcgtgctgctcggccatctgccgggatttcagttccat
catcatttcctgccacagccgggcgaccgcatgtggacgcccgccgactgggcctgggca
ggcggtctcctgaacgctctgctgccgtcgcttttcttcggtgtgcccgtggtttcctcg
cctgcgcagaaattcgatgcccatacggcgttccggatcatcgaagagatggaggtgcgc
aacgccttcatcccgccgacggcgctcaggctcctcaaatccgtcgagcggccgcgcgat
cgctgcgcgctcaagctccgcaccgtcggttcggcgggagaggcgctcgggcgggagacc
ttcgaatgggccagggcggcgctcggcgtcgaggtgagcgaattctacggccagacggaa
tgcaatatcgtcatctcctctgcgaccggtctcggcgtggcgaaggccggctcgatgggc
aaggcggcaccgggtcatcaggtcgcgatcatcgacggcgaggggcgggtgctgccgccc
ggcacggtcgggcaggtggcgatcaggcgtcccgatccggtgatgttcctcggctattgg
cgcaacgaagaggcgaccgaggccaagtttatcggcgactggatgaccaccggcgaccag
ggcgtcatggacgaagagggctatttcacctttttcggccgtgacgacgacgtcatcacg
tcgtcaggctatcgcatcggtccgagcgagatcgaggattgtctcgccgggcacccggac
gtccagctcgccgcggccgtcggcaaaccggacccgctccggaccgagatcgtcaaggcc
tatgtcgtgctgaaacccggcgtcgctgccggcgacgagaccgcggcagggatccgcgac
tgggtgaagaacaggctgtcgatgcatgaatatccgcgcgagatcgctttcgtcgacagc
ctgcctttgaccacctcgggcaaggtgatccgccggcttctgcgggagaaggcggcggca
gaggcgcgcgccgcgtccggcggctga

DBGET integrated database retrieval system