KEGG   Sinorhizobium meliloti BL225C: SinmeB_2581Help
Entry
SinmeB_2581       CDS       T01884                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:smq00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SinmeB_2581
Enzymes [BR:smq01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SinmeB_2581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2670784..2671401)
Genome map
AA seq 205 aa AA seqDB search
MIGKLKGTIDEIGEDHVVLDVHGVGYVAHCSARTLGKLGSAGEAAVLFIETYVREDQLKL
FGFLSALEREWFRLLQSVQGVGSKVALAVLSTLTPGELANAIALQDKTSISRAPGVGPKV
AVRIVTELKNKAPAFSGEMAPSIGLKQELGEGVAAAPVADAVSALTNLGYSRDQAANAVA
AALKNGGEGGDSAKLIRLGLKELSR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgattggcaagctcaagggcacgatagacgagatcggcgaggatcacgtggttctcgac
gtgcatggggtcgggtatgtcgcccattgctccgcgcgcacgctcggaaagctcggaagc
gctggagaggcggccgtactcttcatcgagacctatgtgcgcgaggatcagctgaagctg
ttcgggttcctgagcgcgttggagcgcgaatggttccgcctgcttcagagcgttcagggt
gtgggatccaaggtggcgctggcggtgctctccacgctgacccccggggaactcgccaat
gccatcgccttgcaggacaagacgtcgatctcgcgcgcgccgggcgtgggtccgaaagtt
gccgtgcgcatcgtcaccgaactcaagaacaaggctccggccttctccggcgagatggca
ccatcgatcggcctcaagcaggagctcggcgaaggcgttgccgcagcgccggttgcggac
gcggtctcggcgctcaccaatctcggctattcgcgagaccaggcggccaacgccgttgcg
gctgcgctgaaaaacggcggggagggcggcgacagcgccaagctgatccgcctcggcttg
aaggaactgtcgcggtga

DBGET integrated database retrieval system