KEGG   Sinorhizobium meliloti BL225C: SinmeB_2919Help
Entry
SinmeB_2919       CDS       T01884                                 

Definition
Alkaline phosphatase D-related protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:smq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SinmeB_2919
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SinmeB_2919
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SinmeB_2919
Enzymes [BR:smq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SinmeB_2919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3057199..3058761)
Genome map
AA seq 520 aa AA seqDB search
MAALRNTLTRRSFLFSAGAAGLVASSGLATPFYARGYGRPEFAHGVQSGDVDTGSGMIWT
RVDRPARVSVEYSTTESFSNAVRLADIDATPLTDCAVKCRLHNLLPDQDIFYRFIATDLY
DANRVSEPVVGRFRTAPLRRRSVRFVWSGDTAGQGWGIDEVGMKTYSTMRLHEPDFFIHS
GDTIYADNPIPDEIKLRDGGMWKNRIVTPEKRDVARTLEEYRGQWKYNLLDEHVRRLHAE
CPTFYQWDDHEVLNNWSASTDLSDDPRYPEKDVAVYAARAARAFHEMTAIRTLPTEPGRI
FRKIAYGPLLDVFFVDLRSYRGPNQEEGGGGLFGWRQADWLKRELAASSATWKVIACDMP
IGLIVWDDYSARRGSDAIADGDHGAPKGRESEFADLLRFVRDNAIENLVWLTADVHYTAA
HHYDPSRAAFKDFSPFWEFVSGPLHSGTYGPKELDMTFGPEVRFMKASGGGIDSNLPPSA
GLQFFGIVDISGQTRQMTVRLMDRQDQELWRVTLDPAVSA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
ttggccgctcttcgaaacaccctcaccaggcgttctttcctcttctccgccggcgccgca
ggtcttgtcgcttcttccggtctcgccacgccgttctatgcgcgcggctacgggcggccg
gaattcgcccatggggtacagtccggcgacgtcgatacgggctcggggatgatctggacg
cgggtcgatcggccggcgcgcgtttccgtcgaatattcgaccacggaaagcttttcgaat
gccgtgaggcttgccgatatcgatgcgacgccgctgaccgactgcgccgtcaagtgccgg
ctccacaatctgctgccggaccaggacatcttctatcgcttcatcgcgaccgatctctac
gacgccaatcgcgtctccgaaccggtcgtcgggcgcttccggacggctcccttgcgccgc
cgctccgtgcgcttcgtctggtccggcgacacggcggggcagggctggggcatcgacgag
gtcggcatgaagacctattcgaccatgcggctgcacgagccggatttcttcatccattcc
ggcgacacgatctatgccgacaatcctatccccgacgagatcaagctgcgcgacggcggc
atgtggaagaaccggatcgtcacgcccgagaagcgagacgtcgcgcggacgctcgaggaa
tatcgcggccagtggaaatacaacctgctcgacgagcatgtgcggaggctccatgccgaa
tgtcccaccttctatcagtgggacgaccacgaggtcctgaacaactggtcggcctcgacc
gatctcagcgacgacccgcgctatccggagaaggatgtcgccgtctatgccgcccgcgcg
gcccgcgcgtttcacgagatgacggcgatccgcacgctgccgacggagcccggccgcatt
ttccgcaagatcgcctatggtccgctgctcgacgtcttcttcgtggatctgcgctcctat
cgcggccccaaccaggaagagggggggggcggcctcttcggctggcggcaggcggactgg
ctgaagcgcgagcttgcggcgtccagcgccacctggaaggtgatcgcctgcgacatgccg
atcggcctcatcgtttgggacgactattcggcaaggcgcggatcggatgccattgccgac
ggcgaccatggcgcgccgaaggggcgcgagagcgaatttgcggacctcctgcgcttcgtc
cgcgacaatgcgatcgagaacctcgtctggctgacggcggacgtgcattacacggcggcg
catcactacgatccctcgcgggctgccttcaaggacttctcgccgttctgggagttcgtc
tccgggccgcttcattccggcacctacggcccgaaggagctcgacatgaccttcggcccc
gaggttcgcttcatgaaggcgtccggcggaggaatcgacagcaacctgccgccgtcggcg
ggccttcaattcttcggcatcgtcgatatcagcggccagacgcggcagatgacggtgcgg
ctgatggaccggcaggatcaggaactctggcgggtaaccctcgatccggcggtttccgct
tga

DBGET integrated database retrieval system