KEGG   Sinorhizobium meliloti BL225C: SinmeB_2930Help
Entry
SinmeB_2930       CDS       T01884                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:smq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SinmeB_2930
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SinmeB_2930
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SinmeB_2930
Enzymes [BR:smq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SinmeB_2930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3066252..3067433
Genome map
AA seq 393 aa AA seqDB search
MTKARKALENYRRVVIKIGSALLVDRRTGLKKSWLDALCADIAALRAKGVEVLVVSSGAI
ALGRTVLDLPAGALKLEESQAAAAVGQIVLARAWSESLSTHAIVAGQILLTLGDTEERRR
YLNARATIGQLLKLGSVPIINENDTVATTEIRYGDNDRLAARVATMVGADLLVLLSDIDG
LYTAPPHLDPNARFLETVAEITPEIEAMAGGAASELSRGGMRTKIDAGKIATTAGCAMII
ASGKPDHPLAAIEAGARSSWFAPSGSPVTARKTWIAGQLLPAGSLSIDAGAETALRSGKS
LLPAGVRQVTGSFSRGDTIAIIGASGREIARGLAGYDADEARQIAGKKSAEIAAILGYAG
RTAMVHRDDLVMTAPSGARLVEESDEGKGKLHA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaggcccgcaaagcgctcgagaattaccgccgggtcgtcatcaagatcggctcg
gcactcctcgtcgaccgcaggaccgggctgaagaagagctggctcgacgcgctctgcgcc
gacattgcggccctcagggccaagggcgtggaagtgctcgtcgtctcctcgggagcgatt
gcgcttggacgcacggtgctcgacctgccggcgggtgcgctgaagctcgaagagagccag
gcggccgccgccgtcggccagatcgtgctggcgcgtgcctggtcggagagcctctcgacc
catgcgatcgtcgccggccagatcctcctgacgctgggcgacaccgaggagcgccggcgc
tacctcaatgcccgcgcgacgatcggtcagcttctgaagctcggctcggtgccgatcatc
aacgagaacgacacggtcgcgaccacagaaatccgctatggcgacaacgaccggctggca
gcgagggtcgcgaccatggtcggcgccgatctcctggtcctgctctcggatatcgacggg
ctctataccgcgccgccgcatctcgatccgaacgcccgtttcctcgaaacggtcgccgaa
atcacgcccgaaatcgaggcgatggcgggcggcgctgcctccgagctttcgcgcggcggc
atgcgcaccaagatcgacgccggcaagatcgcaaccactgccggctgcgcgatgatcatc
gcctccggcaagccggatcatccgctggccgcgatcgaggcgggcgcgcgctcgtcctgg
ttcgcgccatcaggctctccggtgaccgcccgcaagacctggatcgccggacagctcctg
ccggccggttcgctctcgatcgatgccggagcggaaacggcgctgcgttccggcaagagc
ctgctgccggccggcgtccggcaggtgacgggaagcttcagccgcggcgatacgattgcg
ataatcggcgcttccggccgcgagatcgcccgcggtcttgccggctacgatgccgacgag
gcgcgccagatcgccggcaagaagtcggccgagatcgccgccatcctcggctatgccggc
cgcaccgccatggtgcatcgcgacgatctggtcatgacggctccatcgggcgcgcgcctt
gtagaggaaagcgacgagggaaagggcaagctccatgcttga

DBGET integrated database retrieval system