KEGG   Sinorhizobium meliloti BL225C: SinmeB_2951Help
Entry
SinmeB_2951       CDS       T01884                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SinmeB_2951
   00052 Galactose metabolism
    SinmeB_2951
Enzymes [BR:smq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SinmeB_2951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3086968..3087984
Genome map
AA seq 338 aa AA seqDB search
MGTDTEIFGHLPSGEPVQRVTLKGGGLTASVITWGSVIQDLRLEGHAAPLVLGFENFESY
PAHSSYFGATPGRNANRIGAGRFALEGKAYQLELNESGATHLHGGSDNIAKRNWSIRRRA
EDSVTLEITDPDGRAGYPGNCTITCTYTLKPGGTLNVVYETETDAPTLANVCQHSYFNLD
GGSDAFGHDIMIAADHYLPTDERQIPTGEIRPVAGTAFDLREMTSLGRQLDGGGIAYDHN
FCLSPERVQKRSVALVRSINSGVSLEVLTTEPGVQLYTGEKLDVPVPGLEGRRYGPFAGF
CLETQIWPDAVNHEGFPKAVLRPGETLRQETDYVFTKN
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgggaacagacacggaaatcttcggccacctgccctccggcgagcccgtacagcgcgtg
acgcttaagggcggcgggctgacggcgtcggtgatcacctggggctcggtcatacaggac
ctgcggctcgaaggacatgcagccccgctcgtgctcggcttcgagaatttcgaaagctat
ccggcccattcctcctatttcggcgccacccccggccgcaacgccaaccgcatcggcgcc
ggccgcttcgcgctcgaaggcaaggcctatcagctcgagctcaacgagagcggcgccacg
catctccacggcggcagcgacaatatcgccaagcgcaactggtcgatccgcaggcgggct
gaagacagcgtaacgctcgagatcaccgatccggacggccgtgccggctacccgggcaat
tgcacgatcacctgcacctatacgctgaaaccgggcggcacgctcaacgtcgtctacgaa
actgagaccgacgcgccgaccctcgccaatgtctgccagcacagctatttcaacctcgac
ggcggctcggacgcattcggccacgacatcatgatcgcggcagaccactacctgcccacc
gacgagcggcagattccgacgggcgagatccgccccgttgccggcaccgccttcgatctg
cgcgaaatgacctcgcttggaaggcagctggacggcggcggaatcgcctatgaccacaat
ttctgcctctcgccggagcgcgtgcagaagcgctccgtggcgctcgtacgcagcatcaat
tccggtgtgtcgctggaagtgctgacgacggagcccggcgtgcagctctataccggagaa
aagctcgacgtaccggttcccggcctcgaaggccgccgttacggccccttcgccggcttc
tgcctcgaaacgcagatctggcccgatgcggtgaaccacgaaggtttcccgaaggcggtg
ctgagaccgggcgaaacgctccggcaggaaacggattacgttttcacgaagaactga

DBGET integrated database retrieval system