KEGG   Sinorhizobium meliloti BL225C: SinmeB_2991Help
Entry
SinmeB_2991       CDS       T01884                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:smq00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    SinmeB_2991
Enzymes [BR:smq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SinmeB_2991
   3.1.2  Thioester hydrolases
    3.1.2.-  
     SinmeB_2991
Lipid biosynthesis proteins [BR:smq01004]
 Fatty acid synthase
  Component type
   SinmeB_2991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3127088..3127729)
Genome map
AA seq 213 aa AA seqDB search
MALKDFLPILFGLTMTIVLSAAARAEPVSLVGFGDSLMAGYQLPPEDAFPARLEKALKEK
GIDVTIANAGVSGDTTSSGLARIDWSIPEGTDGVILELGANDALRGIPPEETRKNLEAMV
ARLKERGVAVLLAGMMAPPNMGPDYAARFNPIYPDLAKEHNLVFYPFFLDGVVTEVGLKL
DDGMHPNGGGVGVMVDRFLPTAELFVRSLAKGE
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcattaaaagactttctgcccattttattcggcctgacaatgacaatcgtgttatcg
gcggcggctcgcgccgagcccgtcagcctcgtcggcttcggcgacagcctgatggccggc
taccaactccccccggaagatgccttccccgcccgcctcgaaaaggccctgaaggaaaag
gggatcgacgtcacgatcgccaatgccggcgtttccggcgacacgacctccagcggtctc
gcccgcatcgactggtcgatccccgagggcaccgacggcgtcatcctcgaactcggcgcc
aacgacgcgttgcgcggcatccctccggaggagacgcgcaagaatctggaggcgatggtc
gcacggctcaaggagcgcggcgtcgccgtcctgctcgcgggaatgatggcgccgccgaac
atggggccggattatgcggcgcgcttcaatccgatctatcccgacctcgcaaaggaacac
aatctcgttttctaccctttcttcctcgacggcgtcgtcaccgaggtcggcctgaagctc
gacgacgggatgcatccgaacggcgggggtgtcggcgtcatggtagaccgcttcctgccg
acggcggagcttttcgtccgctcacttgcgaaaggagaatga

DBGET integrated database retrieval system