KEGG   Sinorhizobium meliloti BL225C: SinmeB_3135Help
Entry
SinmeB_3135       CDS       T01884                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SinmeB_3135
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SinmeB_3135
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SinmeB_3135
Enzymes [BR:smq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SinmeB_3135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3303788..3304627
Genome map
AA seq 279 aa AA seqDB search
MTARMEQRFADVAAEGRPVLVTYFMGGDPDFDTSLAIMKALRQAGADIIELGVPFSDPMA
DGPAIQLAGQRALKAGQSLAKTLELARLFRAEDQRTPIVLMGYYNPIYIYGVERFLADAL
EAGVDGLIVVDLPPEMDDELCIPALEKGISFIRLATPTTDDRRLPKVLENTSGFVYYVSM
TGITGSALPDPSLIAGAVARIKAHTPLPVCVGFGVKTADHARAIGASADGVVVGTAIVNQ
IASSLTEEGRATEATVPGVEALVRGLAAGVRAARLAAAE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgcatggagcaacggttcgccgacgtggcggccgaggggcgcccggtcctc
gtgacctatttcatgggcggcgacccggatttcgacacgtcgctggcgatcatgaaggcg
ctgcggcaggcgggtgccgacatcatcgaactcggcgtgcccttttccgacccgatggcc
gatggaccggcgatccagctcgccggccagcgcgcgctgaaggcggggcagtctctcgcc
aagacgctggagctcgcccggctcttccgggcggaggaccagcgcacccccatcgtgctg
atgggctattacaacccgatctatatctatggcgtcgagcggttcctggcggacgcactc
gaggccggcgtcgacggcctgatcgtcgtcgatctgcccccggaaatggacgacgaactc
tgcattccggcacttgagaagggcatcagcttcatccgcctggcaacgcccacgacggac
gatcgccgcctgcccaaggttctcgaaaacacgtcgggtttcgtgtattacgtctcgatg
accgggatcaccggctcggcgctgcccgatccgtcgctgatcgccggagcggtcgcgcgc
atcaaggcgcatacgcccttgcctgtctgcgtcggcttcggggtgaagaccgccgaccat
gcgcgcgccatcggcgcatccgcagacggcgtcgtcgtcggcacggcgatcgtcaatcag
atcgcgtcgagcttgaccgaagaaggccgggcaacggaagcgacggtcccgggtgtcgaa
gcgctcgtcagggggcttgcggccggcgtacgggcggcacggcttgctgcagccgaataa

DBGET integrated database retrieval system