KEGG   Sinorhizobium meliloti BL225C: SinmeB_3168Help
Entry
SinmeB_3168       CDS       T01884                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:smq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SinmeB_3168
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SinmeB_3168
   00630 Glyoxylate and dicarboxylate metabolism
    SinmeB_3168
Enzymes [BR:smq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SinmeB_3168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
3343433..3345604
Genome map
AA seq 723 aa AA seqDB search
MDRVEKYGLQIDAGLHRFLVEEAMPGTGVDADRFFSAFSDLVHDLGPKNRALLVKRDELQ
ARLDGWYREHGAPVDMEAYEAFLREIGYLLPEGPDFYVSTANVDSEIATIAGPQLVVPVM
NARYALNAANARWGSLYDALYGTDAIAETDGAERGKGYNPKRGAKVIAWAREFLDASAPL
AAGRWSDAKSFSVEGATLTVTLADGTKSAPRNSVQFAGYAGDPAAPSEIVLRRNGLHIVI
VLDATTPIGKADAAGISDVVLESAITTIMDCEDSVAAVDAEDKVLVYCNWLGLMKGDLEE
EVTKGGRAFTRRLNPDRAYTAPDGATLTLPGRSLMLVRNVGHLMTNPAVLDRDGEEVPEG
LMDAMVTALIALHDIGRNGRRANSRSGSMYVVKPKMHGPEEVAFACEIFARVEAALGLPA
NAMKMGIMDEERRTTVNLKECIRAARERVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMK
QAPWISAYENWNVDVGLECGLSGHAQIGKGMWAMPDLMAAMLEQKIVHPKAGANTAWVPS
PTAATLHATHYHRVNVAEVQASLKSRTRAKLADILSVPVAARPNWTEEEIQRELDNNAQG
ILGYVVRWVDQGVGCSKVPDINNVGLMEDRATLRISAQHMANWLHHGIVSEAQIVETMQR
MAAIVDGQNAGDPNYQPMAGRFEESIAFQAALDLVLKGREQPNGYTEPVLHRRRLELKAK
QGA
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcgttgagaaatatggattgcagatcgatgcggggctccaccgctttctggtc
gaagaggcgatgccgggcaccggcgtcgacgcggatcggttcttttccgccttctctgat
ctcgttcacgatctcggaccgaagaaccgggcccttctcgtcaagcgcgacgagctgcag
gccaggctcgacggctggtatcgcgagcatggtgccccggtcgacatggaagcctatgaa
gccttcctgcgggagatcggctacctcctgcccgaaggtcccgatttttacgtctcgacc
gcaaatgtcgattccgagatcgcgacgatcgccgggccgcagcttgtcgtgccggtgatg
aacgcccgctatgcgctcaatgccgccaatgcccgctggggatcgctctacgacgccctt
tacggcaccgatgcgatagccgagaccgacggggccgagcgcggcaagggatacaatccg
aagcgcggtgccaaggtcatcgcctgggcgcgagaatttctcgacgcgagcgccccgctg
gcggccggccgctggagcgatgccaaatcgttctcggtcgagggagcgacgctaaccgta
acgcttgccgacggcacgaagagcgcgccgcgcaattccgttcagttcgccggctatgcc
ggtgaccccgcggcgccgtccgagatcgttctgcgtcggaacggccttcacatcgtcatc
gtcctcgacgcgacgacaccgatcggcaaggccgacgccgccggcatttccgacgtcgtt
ttggaatcggcgatcaccacgatcatggattgcgaggattcggtcgcggccgtcgatgcc
gaggacaaggtgctcgtctactgcaactggctcgggctgatgaaaggcgatctcgaggag
gaggtgaccaagggcggcagggcgttcacccggaggctcaaccccgatagggcctatacg
gctccggacggtgcgacgctgacactgccggggcggtcgctgatgctggtgcgcaatgtc
ggccacctgatgaccaaccccgcggtcctcgaccgggacggcgaagaggtgccggaaggc
ctgatggacgccatggtgacggcgttgatcgcactccacgacatcggccggaacggtcgg
cgggcgaattcccgcagcggctccatgtatgtggtcaagccgaaaatgcatgggccggag
gaagtcgccttcgcctgcgagatattcgcccgcgtagaggcggcgctcgggcttccggcc
aacgcgatgaagatgggaatcatggacgaggagcggcggacgaccgtcaacctcaaggaa
tgcatccgcgccgcccgcgaacgggtcgtcttcatcaataccggcttcctcgaccgcacc
ggcgacgaaatccacacttcgatggaagccggaccgatgatccgcaagggcgacatgaag
caggcgccgtggatatcggcctatgagaactggaacgtcgatgtcggtcttgaatgcggg
ctttccggccacgcccagatcggcaagggcatgtgggcgatgccggacctgatggcggcg
atgctggagcagaagatcgtccatccgaaggcgggcgcgaacacggcctgggtaccgtcg
ccgacggccgcgactctgcacgcgacccactatcaccgcgtcaacgtcgccgaagtccag
gcgagcctcaagagccgcacccgcgcgaagctcgccgatatcctctccgtgccggtcgcc
gcacggccgaactggaccgaggaggaaatccagcgcgaactcgacaacaatgcgcagggc
attctcggttatgtcgtgcgctgggtcgaccagggcgtcggctgctccaaggtgcccgac
atcaacaatgtcggcctgatggaggaccgcgcgacgctgcgcatctcggcgcagcatatg
gcgaactggctgcatcacggcatcgtcagcgaagcgcagatcgtcgaaaccatgcagcgc
atggcggcgatcgtcgacgggcagaacgccggcgatccgaactatcagccgatggccggc
cgcttcgaggagtcgatcgcctttcaggcggcgctggatctcgtgctcaagggccgcgag
cagccgaacggctataccgagccggtcctgcaccgccgccggctggagctgaaggcgaag
cagggggcataa

DBGET integrated database retrieval system