KEGG   Sinorhizobium meliloti BL225C: SinmeB_3238Help
Entry
SinmeB_3238       CDS       T01884                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smq00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SinmeB_3238
Enzymes [BR:smq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     SinmeB_3238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3429401..3430723
Genome map
AA seq 440 aa AA seqDB search
MAMLPQEIIRKKRDGDRLDPAEIAGFIAGVTDGSVSEGQAAAFAMAVWFSGMNRDECVAL
TLAMRDSGETLDWSDLARPIVDKHSTGGVGDNVSLMLAPIVAACGAAVPMISGRGLGHTG
GTLDKLESIPGYDIQPSPELFRRVADEVGCAIIGQTADLAPADKRLYAIRDVTATVDSVP
LITASILSKKLAAGLRSLVLDVKLGNGSFMTDPAETEVLARSLVEVANGAGVRTSALITD
MNEPLADAAGNALEIENCLAYLRGEKAGTRLDQVVMALAAEMLVAAGIAAHEAEAEAMAR
RVLGSGEAMERFGLMVHRLGGPADFVDRPGAYLAKAPAILAVPAGRHGYLTSCKTRELGM
AVIELGGGRIRPDDRIDHRVGLTGLRPLGTKVEKGEPIAFVHAADQSQAEAIAKRVVTLY
AIADEEPARRPVIVSKLRAG
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggccatgcttccgcaggaaatcatacgaaagaaaagggacggcgatcggctcgatccg
gcggagatcgccggtttcatcgcgggcgtgaccgatggctcggtctcggaagggcaggcg
gctgccttcgccatggcggtctggttctccggcatgaatcgcgacgaatgcgtggcgctg
acgctggcgatgcgcgattccggggaaacgctcgactggagcgatctcgcacgccccatt
gtcgacaagcactcgacgggcggagtcggcgacaatgtctcgctcatgttggcgccgatc
gtcgccgcctgcggtgcggccgtgccgatgatttcgggccgggggctcggccacaccggc
gggacgctcgacaagctcgaatcgatccccggctatgacatccagccttcgccggaactg
ttccgccgcgtggccgacgaggtcggctgcgcgatcatcggccagacggccgatctggcg
ccggccgacaagcgcctctatgcgatccgcgacgtgacggcgacggtcgattcggtgccg
ctgatcaccgcatcgatcctgtcgaaaaagctcgccgcagggctacggtcgctggtgctc
gacgtcaagctcggcaacggctccttcatgaccgatcctgccgaaaccgaagtcctggcg
cgttcgcttgtcgaggtcgccaatggtgcgggcgtgcgcacctctgcgctgatcaccgac
atgaacgagccgctggcggacgcggccggcaacgcgctcgaaatcgagaactgcctggcc
tatctgcgcggcgagaaagcgggaacccgcctcgatcaggtcgtgatggccttggctgcg
gagatgctcgttgcagcgggtattgcggctcacgaagccgaagccgaagccatggcgcgg
cgcgttttggggagcggggaggcgatggagcgcttcggcctcatggtgcatcggctcggc
ggccctgccgattttgtcgatcgcccgggcgcctatcttgccaaggcacccgcgatcctt
gccgtgccggcgggccggcatggttatctcacgtcctgcaagacgcgcgaactgggaatg
gcagtcatcgagctcggcggcgggcgcatccgcccggatgaccggatcgatcaccgcgtc
ggtcttaccggcctgaggccgctcgggacgaaagtcgaaaagggcgagccgatcgccttc
gtccatgctgccgaccaaagccaggccgaggcgatcgcaaaacgggtcgtaacgctctat
gcgatcgcagacgaggagccggcgcgacggccggtgatcgtttcgaagctcagagcggga
tga

DBGET integrated database retrieval system