KEGG   Sinorhizobium meliloti BL225C: SinmeB_3266Help
Entry
SinmeB_3266       CDS       T01884                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:smq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SinmeB_3266
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SinmeB_3266
   00052 Galactose metabolism
    SinmeB_3266
   00500 Starch and sucrose metabolism
    SinmeB_3266
   00520 Amino sugar and nucleotide sugar metabolism
    SinmeB_3266
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SinmeB_3266
   00524 Butirosin and neomycin biosynthesis
    SinmeB_3266
Enzymes [BR:smq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SinmeB_3266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3459308..3460327
Genome map
AA seq 339 aa AA seqDB search
MPNASEHSFPFPILIGDIGGTNARFALLTDAYGEPKQLAPIRTGDFATIEEAMQKGILDK
TSVQPRSAILAVAGPIKGDEIPLTNAGWVIRPKDMLASLGLEDVLVINDFEAQALAIAAP
ADQDVVQIGGGAVRPFHSRVVLGPGTGLGVAGLVYAQHTWIPVPGEGGHVDIGPRTERDF
RIWPFLEPIEGRMAGEQILCGRGIMNLYRAVCAANGEEAVLADQAAVTTSALSGADAAAV
ETVSLFATYLGRVAGDMALIFMARGGVFLAGGISQKILPALTKPEFRAAFEDKAPHSALM
RTIPTFAVIHPMAALSGLAAFARTPRDFGVAMEGRRWRR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcccaatgcgagtgaacacagctttccctttccgatcctgatcggcgacatcggcggc
accaatgcccgcttcgcactgctcaccgacgcctacggcgaaccgaagcagttggccccg
atcagaacgggcgatttcgccacgatcgaggaggcgatgcagaaaggcatcctcgacaag
acctccgtccagccgcgctcggcgatcctcgccgtggccgggccgatcaagggcgacgag
ataccgctgacgaatgccggctgggtgattcgtccgaaggacatgctggcgagcctcggg
ctggaggatgtgctggtcatcaacgacttcgaggcccaggcgctcgccatcgccgcgccg
gccgatcaggatgtcgttcagatcggcggcggagccgtccggcccttccattcgcgcgtc
gtgctcggcccgggaaccggtctgggcgtcgccggactggtctatgcgcagcatacctgg
atacccgtgcccggcgagggcggtcatgtcgatataggtccccggacggagcgcgacttc
cggatctggcccttcctcgaaccgatcgagggacgcatggccggcgaacagatcctgtgc
ggccgcggcatcatgaatctctatcgcgctgtctgcgccgccaatggcgaggaagcggtt
cttgcggatcaggcggcagtgacgacgagcgcgctctccggcgccgatgcggcggcggtc
gaaaccgtgtcgctctttgcgacctatctcgggcgcgttgccggcgacatggcgctgatc
ttcatggcgcgcggcggcgtattccttgccggcggcatttcgcagaagatactgccggca
ctgacgaagcccgaatttcgcgcggccttcgaggacaaggcgcctcattcggcattgatg
cggacgattccgaccttcgccgtcattcaccccatggcggcgctctccggcctcgcggcc
tttgcccgcacgccgagggacttcggtgttgcaatggagggacgccgttggagaaggtga

DBGET integrated database retrieval system