KEGG   Sinorhizobium meliloti BL225C: SinmeB_3337Help
Entry
SinmeB_3337       CDS       T01884                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:smq03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3535912..3536517
Genome map
AA seq 201 aa AA seqDB search
MAKRVTGPEIEKLIQLLAKVPGLGPRSARRAALHLVKKKEQLLGPLAEAMGEAHRKVKIC
SCCGNVDTIDPCTVCTDERRDQAVIIVVEDVADLWALERAGAMNAAYHVLGGTLSPLDGI
GPEDLNIRGLIDRVAKGGVRELIIAVNATVEGQTTAHYITDQLEGMEVRITRLAHGVPVG
GELDYLDEGTLAAALRARTVI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcgagtcaccggtccggaaatcgagaaactcatccagctcctggcgaaagtc
ccgggcctcgggccccgttccgcccgccgcgcggcgctgcatctcgtcaagaagaaggag
cagttgctcggcccccttgccgaggctatgggcgaagcccatcgtaaggtcaagatctgc
tcctgctgcggcaatgtcgacaccatcgacccctgcacggtctgcaccgacgaacggcgc
gaccaggcggtgatcatcgtggtcgaggacgtcgccgatctttgggcgctggagcgcgcc
ggcgccatgaatgccgcctatcacgtgctcggcggcacgctgtcgccgctcgacggcatc
gggcctgaggatctgaacataaggggcctcatcgaccgcgtcgccaagggtggcgtgcgc
gagctgatcatcgccgtcaacgcgaccgtcgagggccagacgacggcgcactacatcacc
gatcaactcgaaggcatggaggtgagaatcacgcgcctcgcccatggcgtgcccgtcggc
ggcgagctcgactatctcgacgagggaacgctggccgccgcgcttagggcgagaacggtg
atttga

DBGET integrated database retrieval system