KEGG   Sinorhizobium meliloti BL225C: SinmeB_3539Help
Entry
SinmeB_3539       CDS       T01884                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:smq00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:smq00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pSINMEB02:complement(69775..70551)
Genome map
AA seq 258 aa AA seqDB search
MTKTAVITGSTSGIGLAIARTLAKTGANIVLNGFGAPDEIRTVTDEVAGLSSGTVLHHPA
DMTKPSEIADMMAMVADRFGGADILVNNAGVQFVEKIEDFPVEQWDRIIAVNLSSSFHTI
RGAIPPMKKKGWGRIINIASAHGLVASPFKSAYVAAKHGIMGLTKTVALEVAESGITVNS
ICPGYVLTPLVEKQIPDQARTRGITEEQVINEVMLKGQPTKKFITVEQVASLALYLAGDD
AAQITGTHVLMDGGWTAQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagactgcggtgataacgggttccacgagcggcatcggattggcgatcgcccgg
accctggcgaagaccggtgccaatatcgtcctgaacggcttcggtgcgccggacgagatc
aggaccgtcacggacgaagtcgcaggcctgagctccggtacggtgcttcatcacccggcc
gacatgaccaagccctccgaaatcgccgacatgatggcgatggttgccgatcgcttcggc
ggcgccgatatcctcgtcaacaatgccggcgtgcagttcgttgaaaagatcgaggatttt
ccggtcgagcaatgggaccggatcatcgccgtcaatctctcctcctcctttcacaccatt
cgtggcgccattccgccgatgaagaagaagggctggggccggatcatcaatatcgcgtcc
gctcatggcctcgtggcctcccccttcaagtccgcctatgtcgccgccaagcatggtatc
atggggttgacgaagaccgtggcgctggaggtggcggagagcggtatcaccgtgaactcg
atctgccccggctacgttctgacgccgctcgtcgaaaagcagataccggatcaggcgaga
acgcgcggcatcaccgaggaacaggtgatcaacgaggtgatgctcaagggacagccgacg
aaaaagttcatcaccgtcgaacaggttgcctccctggcgctctatcttgcaggcgacgat
gccgcccagatcaccgggacgcatgttttgatggatggcggctggacggcgcagtag

DBGET integrated database retrieval system