KEGG   Sinorhizobium meliloti BL225C: SinmeB_3540Help
Entry
SinmeB_3540       CDS       T01884                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:smq00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pSINMEB02:70848..72341
Genome map
AA seq 497 aa AA seqDB search
MGGYILAIDQGTTSTRAIVFDGNQKIAGVGQKEFKQHFPKSGWVEHDPEEIWQTVVSTVK
EAIEKSGITANDIAAIGITNQRETVVVWDRETGKPIHNAIVWQDRRTAAFCDKLKKKGLE
KTFVKKTGLLLDPYFSGTKLNWLLSNVKGAQVRAAKGELCFGTIDTFLIWRLTGGECFCT
DATNASRTLLYNIAENAWDDELTEVLRVPKEMLPEVKDCAADFGVTDPSLFGAAIPILGV
AGDQQAATIGQACFKPGMLKSTYGTGCFALLNTGKDMVRSKNRLLTTIAYRLDGETTYAL
EGSIFVAGAAVQWLRDGLKVIKAAPDTGSLAESADPSQEVYLVPAFTGLGAPHWDPDARG
AIFGMTRNTGPAEFARAALEAVCYQTRDLLEAMHKDWRRNGNDTVLRVDGGMVASDWTMQ
RLSDLLDAPVDRPVILETTALGVAWLAGSRAGVWPKQEAFAKSWARDRRFEPHMDEATRK
VKLKGWRSAVKRTLIAA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgggcggatatattctcgcgatcgatcagggcacgacgtccacgcgcgcgatcgttttc
gacggcaaccagaaaatcgcgggcgtcgggcagaaagagttcaagcagcactttccgaag
tcaggctgggtggagcacgatccggaggagatctggcagacggtcgtcagcacggtcaag
gaagcgatcgagaagtccggcatcaccgcgaacgatattgccgcgatcggcatcaccaac
cagcgggagacggttgtcgtctgggatcgcgagaccggcaagccgatccacaatgccatc
gtctggcaggaccgccgcactgccgccttctgcgacaagctcaagaagaagggactggaa
aagaccttcgtgaagaagaccggtctgctgctcgatccctatttttcgggaacgaagctc
aactggctgctttccaatgtgaagggcgcgcaggtgcgcgcagccaaaggcgaactctgc
ttcggcactatcgacaccttcctgatctggcggttgacgggcggcgagtgcttctgcacc
gacgcgacgaatgcctcgcgtaccctcttatacaatatcgccgagaatgcctgggacgac
gagctcaccgaggtcctgcgcgtgccgaaggagatgctgccggaagtgaaggactgcgcg
gccgacttcggcgtcacggatccgtctctcttcggcgcggcgatcccgatcctcggcgtt
gccggcgaccagcaggcggcaacgatcggtcaggcctgtttcaagccgggcatgctgaaa
tcgacctacggtacgggctgcttcgccttgctcaacaccggcaaggacatggtccgttcg
aagaaccgccttctgaccaccatcgcctaccgcctcgacggtgaaacgacctatgcgctc
gaaggctcgatcttcgtagccggtgctgccgtgcaatggctgcgcgacgggctcaaggtg
atcaaggcggcgcccgatacaggctcgcttgccgagagcgccgatccctcgcaggaggtc
tatctggtgccggccttcaccggcctcggagcgccccattgggatccggatgcgcggggc
gcgatcttcggcatgacgcgcaataccggcccggcagagttcgcacgggcggcactcgag
gccgtctgctaccagacccgcgacctgctggaggccatgcacaaggattggcgccgcaac
ggcaatgatacggtcctgcgcgtcgatggcggcatggtcgcctccgactggacgatgcag
cgcctgtcggacctgctcgacgctccggtcgaccgcccggtcattctcgaaaccaccgcg
ctcggcgtcgcctggcttgcaggcagccgagccggcgtctggccaaagcaggaggcgttc
gccaagtcctgggcccgcgaccgccgcttcgagccgcatatggacgaggccacgcgcaag
gtgaagctcaagggctggcgcagcgcagtcaagcggacgttgattgctgcctga

DBGET integrated database retrieval system