KEGG   Sinorhizobium meliloti BL225C: SinmeB_3581Help
Entry
SinmeB_3581       CDS       T01884                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:smq00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pSINMEB02:119609..121621
Genome map
AA seq 670 aa AA seqDB search
MHMPLTSPNHFNSDARTPDRLELGVCYYPEQWPRGKWAEDARRMVELGLSWVRIGEFAWA
KIEPRSGEFHWEWLDEAIDVLGKAGLKVILGTPTAAPPKWLVNRYPEILPVDATGAVRKF
GARRHYCFSSRRYRSEAARITEAMARRYGEHIYVHAWQTDNEYGDHDTIYSYSAEAVGAF
RLWLAERYGSIDELNRAWGTSFWSMRYDSFEEIDLPNNLVEEPSPTHGVDFIRFSSDQVK
SFNKAQVDIIRALSPGRPVTHNFMSQNTDFDHYRVGEDIDIASWDVYPMGGLLNGRLAAK
DKEHYLRVGDPDQPAFNHDLYRAVGRGRVWVMEQQPGPVNWAAHNQSPADGMVRLWTWLA
YAHGVDMVSYFRWRQAPFAQEQFHAGLLLPNSEADQGYLEVAEVVAEMKRLPEGEVRGKA
QVAIVLDYESRWATRVLPQGRSYSASAVALDWYSTVARLGVDVDFIGQHSDIAGYKLILA
PDLVIAEEAFVERLTRADAKVVFGARSGSKTRDMHIPEGLPPGPLAKLIDISVSRVESLP
EFHSETVLYGNEAYEAGGWRETVRTSETVIASFDGEYRNGAPALVGSDKARYLAVAANGA
LLDKVIGDALGWAGLESLPDLGDLRVTRRGNLRFAFNFGRIPAEVPAGASAEFYVGGRTL
KPVDVAIWRE
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
ttgcacatgccgctgactagccccaatcacttcaactccgacgcacggacgcctgacagg
cttgagctcggcgtgtgctactacccggaacaatggccgcgcgggaaatgggcggaggac
gcccggcgaatggtcgagctcggcctctcctgggttcgcatcggtgagttcgcctgggcg
aaaatagagccgcggtcgggcgaatttcattgggaatggctggacgaggcgatcgatgtt
ctgggcaaggccggcctcaaggtcatcctcggcacgccgacggcggccccgccgaaatgg
ctcgtgaaccgctatcccgagattctgccggtggacgcgaccggagcggtgcgcaaattc
ggcgcgcgacgccactattgcttctcgagtcggcgttaccgctccgaggcggcgcgcatc
accgaggcgatggcgcgccgctatggcgaacacatctatgtccatgcctggcagacggac
aatgaatatggcgaccacgacacgatctacagctattccgccgaggcggtcggggcgttc
cgcttgtggctggccgaacgctacggctcgatcgatgagctgaaccgcgcctggggcacc
tcattttggtcgatgcgctacgatagcttcgaggaaatcgacctgccgaacaatctcgtg
gaggagccgagccccacccacggggtggatttcatccgcttctcttccgatcaggtgaag
agcttcaacaaggcgcaggtcgacatcatccgggcgctttcgcccgggcgaccggtgacg
cacaacttcatgtcgcagaacaccgatttcgatcattacagggtgggcgaggacatcgac
atcgcctcctgggacgtctatccgatgggcggcctgcttaacggacggctcgcagcgaag
gacaaggagcattatctccgggtcggggatcccgaccagccggccttcaaccacgatctc
taccgcgccgtcggccgcggccgcgtctgggtcatggagcagcagccggggccggtgaac
tgggcggcgcacaaccagtcccccgccgacggcatggtgcggctctggacgtggctcgcc
tatgcccatggggtcgacatggtctcctatttccgctggcggcaggcgcctttcgcgcag
gaacagtttcacgcgggcctccttcttccaaacagcgaggcggaccagggctatcttgaa
gtcgccgaagtcgtcgctgaaatgaagcgcctgcccgagggagaggtgcgtggcaaggcg
caggtcgcgattgttctcgactacgaatcgcgctgggccacacgcgtcttgccgcagggg
cggagctattccgcttcggcggttgcgctcgactggtattcgacggtggcccgcctcggc
gtcgatgtggatttcataggacagcactccgatatcgccggatacaagctgatccttgcc
ccggatctcgtgatcgccgaggaggccttcgtcgagcggctcacgcgagcggatgccaag
gtggtcttcggcgcgcgcagcggcagcaagacgagggacatgcacatccccgagggacta
ccaccaggaccgctggcgaagctcatcgatatcagcgtctcgcgggtcgagtcgctgccg
gagtttcacagcgagactgttctctatggcaacgaggcctatgaggcgggcggttggcgc
gagacggtcaggacgagcgaaactgtcatcgcaagcttcgacggggagtatcgtaacggc
gcgccggcgctcgtcggcagcgacaaggcacgctacctggcggttgcggccaacggcgca
ttgctcgacaaggtgatcggcgacgcgctcggctgggctgggttggaaagcctgcccgac
ctcggcgatcttcgcgtgacgcgccgtggcaatctccgtttcgccttcaatttcggccgg
atccccgcggaggttcccgcgggcgcctcggccgagttctacgtgggaggccgcacgcta
aaacccgtcgatgttgcgatctggagggaatga

DBGET integrated database retrieval system