KEGG   Sinorhizobium meliloti BL225C: SinmeB_3586Help
Entry
SinmeB_3586       CDS       T01884                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq00040  Pentose and glucuronate interconversions
smq00052  Galactose metabolism
smq00500  Starch and sucrose metabolism
smq00520  Amino sugar and nucleotide sugar metabolism
smq01100  Metabolic pathways
smq01130  Biosynthesis of antibiotics
Module
smq_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:smq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SinmeB_3586
   00052 Galactose metabolism
    SinmeB_3586
   00500 Starch and sucrose metabolism
    SinmeB_3586
   00520 Amino sugar and nucleotide sugar metabolism
    SinmeB_3586
Enzymes [BR:smq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SinmeB_3586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: AEG07897
JGI: SinmeB_3586
UniProt: A0A0E0UMM7
Position
pSINMEB02:complement(127525..128430)
Genome map
AA seq 301 aa AA seqDB search
MDRVRTVRKAVIPVAGNGTRFLPATKAVPKEMLTIVDRPVVQYAVDEARQAGIEHIVFVT
SRNKQVIEDHFDDAPELISSLSRSGKSAQISELEAMLPAAGSVSFTRQQAPLGLGHAVWC
ARDLIGDEPFALLLPDMVSFGARGCVAGLMDLYHEVGGNVVGVEQCAPEEASKYGIVGKG
ETVRHGFSVTEMVEKPAAGKAPSNYYLNGRYILQPEIFSILAHQTRGAGNEIQLTDGMLT
LSQSQSFHAHPYEGRTFDCGSKQGFIEANVAFALARADIGDIVFESVRDMVLSHESRIRA
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggaccgtgtcaggaccgtcagaaaagcagtaatcccggttgccggaaacggaacgagg
ttccttccggcgacgaaggcagtgcccaaggagatgttgacgatcgtcgaccggccagtc
gttcagtatgccgtggacgaggcccgccaggccggaatcgaacatatcgtcttcgtcacc
agccggaacaagcaggtgatcgaggaccatttcgacgacgcgccggagctcatctcgtcg
ctttcacgctccggcaaaagcgcgcagatttccgaactcgaggccatgttgccggcagcc
ggctcggtcagctttacccgtcagcaggcccccctcggcctcgggcacgcggtatggtgt
gcgcgtgacctgatcggcgacgagcccttcgcgcttctgctgccggacatggtctccttc
ggcgcgcgcggttgcgtggccggcctcatggacctctatcacgaggttggcggcaacgtc
gtcggcgtcgagcaatgcgcccccgaggaagcatcgaaatacggcatcgtcggcaagggc
gagacggtccggcacggtttctccgtaaccgagatggtcgaaaagcccgccgccggaaag
gcaccgtccaactactatctcaatggtcgctacatccttcagccggaaatcttctcgatt
ctggcccatcagacacgcggcgccggcaatgagatccagttgaccgatggcatgctgacg
ctttcgcaatcccagtccttccacgcgcatccctatgaaggccgcaccttcgactgcggc
tcgaagcagggcttcatcgaagccaatgtcgccttcgcccttgctcgtgcggacatcggc
gatatcgttttcgaatccgtccgcgacatggttctgtctcacgaaagccgcatccgggcg
gcataa

DBGET integrated database retrieval system