KEGG   Sinorhizobium meliloti BL225C: SinmeB_4170Help
Entry
SinmeB_4170       CDS       T01884                                 

Definition
CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:smq02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:smq02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pSINMEB02:770052..771113
Genome map
AA seq 353 aa AA seqDB search
MGRRDVIAIGGSLGAVAALKHLLGKLPGDFAAAVFVVIHVGARGKDLLAEIFNAHSGIPV
TTAVDGEAVERRHVYVAPADHHLLVIDGVIRLGRGPRENLARPAVDPLFRSIGLNYGPRS
VAVVLTGLLNDGAAGLADFKRCGGVTVVQNPSDAVAPDMPMGALRASDVDYRAPLDGLAA
LLVELTGEEAGPPIPVPAEIRLEVDIAFGRQIGSETMLTIANPVPISCPACGGVLSQIKS
WPPLRFRCQVGHAYTSEALAAESEGAVDEALRVALRIIEERVTLSEKMAQDAHRSGFAAA
AAANRRRANEGREHAETLRRAIIGSAPEATAGKLEDASLAVAKHPDPTDPESS
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgggccgccgagacgtcatagccataggaggttcgcttggcgcggtggcagccctgaag
cacttgcttggcaaacttccgggcgacttcgccgccgctgtattcgtcgtcatacatgtc
ggcgcacgcggaaaagatctactcgccgagatattcaacgcgcattccggaattcctgta
acgactgcagttgacggggaggctgtagagcgccggcacgtctatgttgcgccggcagac
caccacctcctcgtcattgacggcgtcatccggcttggccgcgggccccgcgagaacctg
gcccgaccggcggttgaccctctctttcgatcaatcggtttgaattacggaccgcggtca
gtcgcggtcgtactcacggggctgttgaacgacggggccgctggccttgccgatttcaag
cggtgcggtggggtgacagtcgtccagaatccgagcgacgcagttgcgccggacatgcca
atgggcgccctaagggcaagcgacgtcgattaccgcgctcctctcgacggtctcgctgca
ctcctcgttgagctcaccggcgaagaggccggtccgccaattcccgtccccgccgaaatc
agacttgaggtcgatatcgcattcggccgacagatcggttccgagacaatgctaaccatt
gcgaacccggtcccgatctcgtgtccggcctgcggcggcgtactctcgcagatcaagagt
tggccgccgctgcgatttcgttgtcaagtcgggcatgcctatacgtccgaggctttggct
gcggagtcggaaggcgccgtcgacgaggctctgagagttgcccttcggatcatcgaggaa
agggtgactctcagcgaaaaaatggcgcaagatgcgcatcgtagcgggttcgccgccgcc
gccgccgcaaacagaaggcgggccaatgaaggacgggagcatgcggaaacactacgccgc
gccatcattggcagcgcaccggaagcaactgcaggcaaattggaggatgccagtctcgcc
gtcgccaagcatccggatccaaccgacccggaatcatcttga

DBGET integrated database retrieval system