KEGG   Sinorhizobium meliloti BL225C: SinmeB_4266Help
Entry
SinmeB_4266       CDS       T01884                                 

Definition
(GenBank) Acetone carboxylase gamma subunit
  KO
K10856  acetone carboxylase, gamma subunit [EC:6.4.1.6]
Organism
smq  Sinorhizobium meliloti BL225C
Brite
Enzymes [BR:smq01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.6  acetone carboxylase
     SinmeB_4266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetone_carb_G
Motif
Other DBs
NCBI-ProteinID: AEG08549
JGI: SinmeB_4266
UniProt: A0A0E0UPN7
Position
pSINMEB02:complement(873340..873837)
Genome map
AA seq 165 aa AA seqDB search
MTEYSKEVINDLVNGTLPWPQTRRIMSAYKDHDRFFKYLAVLQDRVAWSDPILLPVGDRL
FICDSAEGRVARCECGYSFGDYRRNWKLNAVINVRDTEESLREIYPNSDIPDPRWMEIRE
FFCPECAHLHEVEAAAPGYPIVHDFEPDLEGFYRDWLGKPLKDLS
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaatattcgaaggaagtcatcaacgacctcgtcaacggcacgctcccctggccg
cagacgcggcggatcatgagcgcctataaggaccacgaccgcttcttcaaatatctggct
gtgctgcaggatcgcgttgcctggagcgatccgatcctgctgccggtcggcgaccgcctc
ttcatctgcgacagcgccgagggccgggtcgcccgctgcgaatgcggctactccttcggc
gactatcgcaggaactggaagctcaacgcggtgatcaacgtgcgcgacaccgaggagagt
ttgcgggaaatctacccgaacagcgatatcccggatccgagatggatggagatccgcgag
ttcttctgccccgaatgtgcgcatttgcacgaagtcgaagcggcagcacccggttatcca
atcgtgcatgatttcgagccggacctcgaaggcttctatcgcgactggctcggtaagcct
ttgaaggatctgtcatga

DBGET integrated database retrieval system