KEGG   Sinorhizobium meliloti BL225C: SinmeB_4271Help
Entry
SinmeB_4271       CDS       T01884                                 

Definition
(GenBank) Isoquinoline 1-oxidoreductase
Organism
smq  Sinorhizobium meliloti BL225C
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pSINMEB02:complement(881324..881821)
Genome map
AA seq 165 aa AA seqDB search
MISLTVNGSPHQIDADPATPLLYVLRDELALNGAKYGCGLGQCGSCTVVVDGEAVLSCMV
PIMLLEGREITTIEGLGTIDEPGPLQEAFIELQAAQCGYCIPGMMMSAHALLRRNAQPSE
EEIREALATNLCRCGTHMRILAAIRRAGELMRAASLPATDQGRAG
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgatatcgctgacggtcaacggcagcccgcatcagatcgacgcagaccccgcgacgccg
ctgctttacgtgctgcgcgacgagctggcgctcaacggggccaaatacggctgcggactt
gggcagtgcggctcctgcaccgtcgtcgtcgacggcgaggcggtgctttcctgcatggta
ccgatcatgctgctggaagggcgggagatcaccaccatcgagggcctgggaacgatcgac
gagccggggccgctgcaggaggccttcatcgagctgcaggcggcgcaatgcggctattgc
attccgggcatgatgatgagcgcgcatgcgcttttgcgccgtaacgcgcagccgagcgaa
gaggaaatccgagaggcgctggcgaccaatctttgtcgttgcggcacccatatgcgcatt
ctcgcggcgatccggcgcgccggcgaactgatgcgggccgcctcgctgcctgccactgat
caggggagggccggctga

DBGET integrated database retrieval system