KEGG   Sinorhizobium meliloti BL225C: SinmeB_4272Help
Entry
SinmeB_4272       CDS       T01884                                 

Definition
(GenBank) Gluconate 2-dehydrogenase (acceptor)
Organism
smq  Sinorhizobium meliloti BL225C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-ProteinID: AEG08555
JGI: SinmeB_4272
UniProt: A0A0E0UQG1
Position
pSINMEB02:complement(881824..883212)
Genome map
AA seq 462 aa AA seqDB search
MRALRVAIGIAAVILVAAAAFFLFAWRSEIPEDTTAAEARFAAELVAKGAQLAALGNCIA
CHTVPGRPAFAGGLALPTPFGTIYSTNITPDRETGIGGWSEAAFERAMREGVDREGSHLY
PAFPYEHFTRVSADDNRALYAFLMTRVAVKAEALENDLPFPLKFRPLLAGWKLLFLDSGE
REPDPGQSDAWNRGRYLAEGLGHCGACHTPRNPFGAEDRDRHFGGGEAEGWQAYAINTES
KAPIPWDEQSLAFYLRNGWHEFHGVSRGPMAEVTGNLAFLPDSDIAAIATYVRSIMGAPT
PEREQRAAQLREAFEGQRPEQAADSQRSPVSASGSQPGEAIYLAACASCHEGGRRQPFGG
LNFELSTAVNAPNPQNIVNVVLFGLPPADGEASAVMPAFRHLLNDQQVADLLAYMRERFS
EEPPWAGLVEQTARTRSGTYKVAVRPSDGIERAPHHVGAEED
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcgagctttgagggtggcgatcggcatcgcggcagtcatccttgtggctgccgctgct
ttctttttattcgcgtggcgttcggagatccccgaagacaccacggccgcagaggcgcgc
tttgcagcggagttggtcgccaagggggcccaactggcggcgctcggcaattgcatcgcc
tgccacaccgtgcctgggagaccggcatttgccggcggccttgcattgcccacccccttc
ggcacgatctactccaccaacatcacccctgatcgcgaaacaggcatcggcggctggagc
gaggcggcattcgagcgtgccatgagggaaggcgtcgaccgggagggaagtcacctctat
ccggcgttcccctacgagcacttcacgcgtgtatcggcagacgacaatcgcgccctctac
gctttcctcatgacgcgtgttgcggtgaaagccgaggcactggaaaacgaccttccgttt
cccctgaagttccggccgctgcttgccggctggaagctgcttttcctcgacagcggcgag
cgggagccggatcccggccagagcgatgcctggaaccgcggccgctatcttgccgagggc
ctcggccactgtggcgcgtgccatacgccccgcaatccattcggcgccgaagaccgcgac
cggcacttcggcggcggcgaggcggaaggctggcaggcctatgcgatcaacacggagtct
aaggcgccgatcccctgggacgagcaaagcctcgccttctaccttcgcaacggctggcac
gaattccacggcgtttcgcgcggacccatggccgaggtgacgggcaatctggccttcctg
ccggacagcgatatcgcggcgatcgccacctatgtcagatcgatcatgggcgccccgacg
ccggaacgcgagcaaagggcggcgcagttgcgcgaggcttttgaagggcaacgcccggag
caggcggcggatagccagcgttccccggtgagtgcgtcaggcagccagcctggcgaggcg
atctatcttgccgcctgcgcaagctgtcacgagggcgggcggcgccagcccttcgggggg
ctgaatttcgaactcagcaccgccgtcaatgctccgaacccgcaaaacatcgtcaacgtg
gtgctgttcggccttccgccggccgatggagaagcgagcgctgtgatgccggctttccgc
catctgctcaacgatcagcaggtggccgatctccttgcctacatgcgcgagcggttctcg
gaggagccaccctgggcggggctcgtagagcagacggccagaacccgttccgggacctac
aaggtggcagtccggccctctgacggcattgaaagggcgccgcaccatgtcggcgccgag
gaggattga

DBGET integrated database retrieval system