KEGG   Sinorhizobium meliloti BL225C: SinmeB_4277Help
Entry
SinmeB_4277       CDS       T01884                                 

Definition
(GenBank) (2Fe-2S)-binding domain-containing protein
  KO
K13483  xanthine dehydrogenase YagT iron-sulfur-binding subunit
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq00230  Purine metabolism
smq01100  Metabolic pathways
smq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smq00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SinmeB_4277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Motif
Other DBs
NCBI-ProteinID: AEG08560
JGI: SinmeB_4277
UniProt: A0A0E0UQG6
Position
pSINMEB02:885164..885730
Genome map
AA seq 188 aa AA seqDB search
MPSPDRTPKAAPIPPAGSALILLKINGVDHSLSIDPRTSLLDVLREHLSLTGPKKGCNQG
ACGACTVLVDGQRVLSCLSLAVQLEGREITTIEGIASGELHRLQVAFIEHDGFQCGYCTP
GQICSAIGMFQEFQNGLPSAVTGDMAAARIEFSDAEIKERMSGNLCRCGAYVGICEAIHS
AFDREVAK
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgccatctcccgaccgaacgccgaaggcggcacccatcccgcctgccggctcagcgctg
atcctgctgaagatcaacggcgtcgaccattcgctttcgatcgacccgcgcacgtctctg
ctggacgttctgcgtgaacatttgagccttaccgggcccaagaagggatgcaaccagggc
gcctgcggggcctgcacggttctggtggacggccagcgcgtcctgtcctgcctgtcgctg
gcggttcagctcgaaggccgggagatcaccacgatcgaaggcattgccagcggcgagctt
caccggcttcaggtcgcattcatagagcatgacggtttccaatgcggatattgcacgccc
gggcagatctgttcggcgatcggaatgttccaagagtttcagaacggcttgccgagcgcc
gtgaccggggatatggccgcggccaggatcgagttctcggacgctgagatcaaggaacgc
atgagcggcaatctctgccgttgcggggcttatgtcggcatctgcgaggcgatccacagc
gcatttgaccgcgaggtggcgaaatga

DBGET integrated database retrieval system