KEGG   Sinorhizobium meliloti BL225C: SinmeB_4292Help
Entry
SinmeB_4292       CDS       T01884                                 

Definition
(GenBank) ABC-type transporter, integral membrane subunit
  KO
K02054  
putative spermidine/putrescine transport system permease protein
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
Quorum sensing
Module
Putative spermidine/putrescine transport system
Brite
KEGG Orthology (KO) [BR:smq00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    SinmeB_4292
Transporters [BR:smq02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Putative spermidine/putrescine transporter [MD:M00193]
    SinmeB_4292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pSINMEB02:904063..904914
Genome map
AA seq 283 aa AA seqDB search
MKLRTSPVLVEGPMPLMAPAVIFLALFFLVPLGYVVWMSLSQPVIGLQNFGRLLNSSLFA
SVLYNTFKTALLVTLLSLLFAYPLAYAAANGSKRFATFLLTVVALSFWTSYLVRTYAWMV
ILGNQGPVTALLSWFGWDPTPKILFTTFSATLAMTHALIPFMTMSLFAVMKRIDPLYVRA
AENLGAHPFRAFVSVYLPLSAPGIVNGCTLVFITCLGFYVMPVLLGSPRDQMIAGIIGDQ
IEQTLDFGLGSAISIVLLALTLAVYALYNRFFGLDRLWAGGDR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaaactccggacgtccccggtcctcgtggaagggcccatgccgctgatggctccggcg
gtgatcttccttgcgctcttctttctcgttccgcttggctacgtggtctggatgagccta
tcgcagccggtgatcggattgcagaatttcggccggctgctgaattccagtctgttcgcc
tcggtcctttacaacacgttcaagacggcgctcctggtaacgctgctgagccttctcttc
gcctatccgctcgcctatgccgcggcgaacggctcgaagcgctttgcgaccttcctgctg
acggtcgtcgcgctctccttctggaccagctatctggtgcgcacctatgcctggatggtc
atcctcggcaatcaggggccggtgacggcgctcctctcttggttcggttgggaccccacg
ccgaagatcctgttcaccaccttcagtgccaccctcgccatgacccacgcccttattcct
ttcatgaccatgtcgctcttcgccgtgatgaaacggatcgacccgctctatgtccgcgct
gcggaaaatctcggcgcgcacccgtttcgcgccttcgtctccgtctatctgccgctgagc
gcgcccggcatcgtcaatggttgcacgctcgtcttcatcacctgtctcggcttctatgtc
atgcccgtcctgctcgggagcccacgcgaccagatgatcgccggcatcataggagaccag
atcgagcagaccctcgacttcggcctcggctcggcgatttcgatcgtgcttctggcgctg
acgctcgcggtctatgcgctctacaaccgcttcttcggcctcgaccggctttgggcagga
ggtgaccgatga

DBGET integrated database retrieval system