KEGG   Sinorhizobium meliloti BL225C: SinmeB_4293Help
Entry
SinmeB_4293       CDS       T01884                                 

Definition
(GenBank) ABC-type transporter, integral membrane subunit
  KO
K02053  putative spermidine/putrescine transport system permease protein
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq02024  Quorum sensing
Module
smq_M00193  Putative spermidine/putrescine transport system
Brite
KEGG Orthology (KO) [BR:smq00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    SinmeB_4293
Transporters [BR:smq02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Putative spermidine/putrescine transporter [MD:M00193]
    SinmeB_4293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AEG08576
JGI: SinmeB_4293
UniProt: A0A0E0UPM1
Position
pSINMEB02:904911..905741
Genome map
AA seq 276 aa AA seqDB search
MSVWIRSLAILIAAFVAAPMFIVIPMSFSSAASLAFPPPGYTLQNYVNFFSDPNWTRPLT
NSLLIGFGTVCVTMLVAVPASFALVRHVFIGRTVFNLLIMLPMIVPTIVMALGYYIYFGQ
LRLVQSYLGVILAHSCIALPMSTLILTAALKGFDRSVERAAMNLGASPFATFRLITFPIL
RPAFTVAGLFAFIASFDEAVIALFISGRDKATLPRQMFNAVRQEADPTISAASSFLFLLV
LAGVCIWLAPQLVRRRTRPLGQADGNGAAEPAAAAS
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtctggatccgttctctggcaattctgatcgccgccttcgtcgcggcgccgatg
ttcatcgtcattccgatgtccttcagctcggccgcgtcgcttgccttcccgccgcccggc
tatacgcttcagaactacgtcaacttcttctccgacccgaactggacgcggccgttgacc
aacagcctgctgatcggcttcggcacggtctgcgtgacgatgctcgtcgccgttccggcc
tctttcgccctggtgcggcacgtgttcatcgggcgcacggtctttaaccttctgatcatg
ctgccgatgatcgtgcccaccatcgtcatggcgctcggctactacatctatttcgggcag
ctccggctggttcagagctatctcggcgtgattctcgcccacagctgcatcgccctgccg
atgtcgacgctgatcctgaccgcggcgctcaagggcttcgaccgctcggtggagcgcgcc
gcgatgaacctcggagcttcgccgtttgcgaccttccggctgatcacctttccgatcctg
cggccggccttcaccgtcgccgggctcttcgccttcatcgcatccttcgatgaggccgtc
atcgccctcttcatctccggccgcgacaaggcgaccttgccgcgccagatgttcaacgcc
gtccgccaggaggcggatccgaccatctccgccgcctcgtccttcctattcctgctcgtt
ctcgccggcgtctgcatctggctcgcgccgcaactcgtgcgccgccgcacgcgccctctg
ggccaggccgacggcaacggcgcagccgagccggccgccgcggcatcctga

DBGET integrated database retrieval system