KEGG   Sinorhizobium meliloti BL225C: SinmeB_4299Help
Entry
SinmeB_4299       CDS       T01884                                 

Definition
(GenBank) GntR domain protein
Organism
smq  Sinorhizobium meliloti BL225C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pSINMEB02:910740..911510
Genome map
AA seq 256 aa AA seqDB search
MNPVLSDSADELAGTEKVLSFFREQLLSGALKVGDRLLGERELCLALGVSRPVLREALRS
LANLGFLDIRHGKGAFVRKADVGVFGDFLTFCLAQQPDMLDDIMQARVAIECQAIRLACI
RATDSDLSRIGGLLTRLMDTLHNAEDGGAADFAFHMAIVEASRSPALVTVYRSISDLLKR
SHVQRRAETSDAPGITDYLVEAHREVFLSILARDPDKADRMLREHFAIGDELRRKSYIAA
FTRKGAPQEEEKEADS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctgtgctatccgacagtgccgacgaacttgcgggaacggaaaaggttctctcc
ttcttccgggagcagctgttgtccggtgcgctcaaggtgggagacaggctgttgggcgag
agggagctttgcctggccctcggcgtatcgcgaccggtgctgagggaggctttgcggtcg
ctcgccaatctcggctttctcgacatccgccatggcaagggcgccttcgtgcgcaaggcc
gacgtgggcgtcttcggcgatttcctgacgttctgcctcgcccagcagcccgacatgctc
gacgacatcatgcaggcccgtgtcgcgatcgagtgccaggccatccgtcttgcctgcatc
cgcgcgacggatagcgacctctcacgcattggcggcctgctgacccggctgatggacacg
ctccacaacgccgaagacgggggtgctgcggacttcgcctttcacatggcgatcgtcgag
gccagccgcagtcccgcgctcgtcacggtctaccgctcgatatccgaccttctgaagcgc
agccatgtccagaggcgcgccgaaacgagcgacgcgccgggcatcaccgactatctcgtg
gaagcccatcgggaggtcttcctgtccattctcgcgcgcgacccggacaaggccgacagg
atgctgcgcgagcatttcgccatcggcgacgagcttcggcgcaaaagctacatagctgcc
ttcaccaggaagggcgcgccgcaggaagaggaaaaagaagcagacagctag

DBGET integrated database retrieval system