KEGG   Sinorhizobium meliloti BL225C: SinmeB_4300Help
Entry
SinmeB_4300       CDS       T01884                                 

Definition
(GenBank) TRAP dicarboxylate transporter, DctP subunit
Organism
smq  Sinorhizobium meliloti BL225C
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pSINMEB02:911531..912523
Genome map
AA seq 330 aa AA seqDB search
MLNFLKHGRVAGAMLGAALLAGAASATELRYAHVGAEGDIQTVYAAQAAEGIAAATGGEV
TVTVYPASQLGGVAEMVDGVRMGSISMGHHDFASLARLVPEVAVFNAPFIYRDGAHALAA
TDPQSSPALQAINEKLIAQGVRIVGRIYRGDRHISSNFPVKTPADLAGKPFRAVPLELWV
SMVKGFGAIPTPVEVAELPTALMTGVVVGQENPLTMIASNNLNEVQSHLSMTGHMRAVLA
VFINEEVWQGLSEEQRTALTKVLDEEAQKSLKMATESEADLVKELKGRGMTVITEAEGLD
VAAFREKVGAQIGQDFPNFAPLIEQIEAVK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgctgaactttctgaaacatggccgggtggccggcgccatgctgggagccgcattgttg
gccggagccgcttccgcgaccgaattgcgctatgcgcatgtgggcgcagagggagacatc
cagacggtctatgcggcacaggcggcggagggcattgcggccgcgaccggcggcgaagtc
accgtcaccgtttatcccgccagccagctcggcggggtcgcggaaatggtggatggcgtg
cgcatgggctcgatctccatgggccatcatgatttcgcttccctcgcacgattggtgcct
gaggtcgcggttttcaacgcgcctttcatctatcgcgacggcgcccatgcgctcgctgcg
acggacccgcagtcgtcgccggcccttcaggcgatcaacgagaagctcatcgcacagggc
gtgcggatcgtcgggcgcatctatcggggtgaccgccacatctcctccaacttcccggta
aagacaccggcggaccttgccggcaagcctttccgagcggtcccgctcgaactgtgggtt
tccatggtcaagggcttcggcgcgatccccaccccggtcgaagttgccgaactcccgacc
gcgctgatgacgggcgtggtggtcggccaggaaaatccactgaccatgatcgcctccaac
aatctcaacgaggtgcaatcgcatctgtcgatgacgggtcacatgcgcgccgtgctcgcc
gtcttcatcaatgaggaagtctggcagggattgagcgaagagcagcgcacggctttgacg
aaagtcctcgacgaggaggcccagaaatcgctgaagatggcgacggaatccgaggctgat
ctggtcaaggaactcaagggccgcggcatgaccgtcatcacggaggccgaaggactcgac
gtggcggccttcagggaaaaggtcggcgcccagatcgggcaggacttcccgaatttcgca
ccgctcatcgagcagatcgaagcggtgaagtaa

DBGET integrated database retrieval system