KEGG   Sinorhizobium meliloti BL225C: SinmeB_4306Help
Entry
SinmeB_4306       CDS       T01884                                 

Definition
(GenBank) efflux transporter, RND family, MFP subunit
Organism
smq  Sinorhizobium meliloti BL225C
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pSINMEB02:complement(916798..917820)
Genome map
AA seq 340 aa AA seqDB search
MRLMQQMRRYAAGIAIAAAVGAVAFWYATRAVPVSIVTPKRGDAAEIVYASGVVEPRVWA
KVTSTVRERIVEQCNCEGERVEKGAVLARLDDTEARAILSELQARLSLAQEEYRRKLALA
ERNTISEQTVDRARTDVAQLEALIAGQEARLAAYVLRAPSDGRVLRQDGEIGEVAEPGTV
LFWVGEPRPLIVEAEVNEEDIPRVEVGQNAYLRSDAFPERALEAVVDSITPKGDPVTKTY
RVRLRLPEDTPLRIGMSTDVNVVVRLSRNALVIPAAAVSGTRVAVVEGGTAKLREIETGI
RGTDGVEVLSGLEETARIISPLSPDFADGTRVDVVQTATN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgcggctgatgcagcagatgaggcgctacgcggcaggtattgcgatagccgccgcagtc
ggtgcggttgccttctggtatgcgacccgggcggtgcccgtttcgatcgtgacgccgaag
cgcggcgatgcggcggagatcgtctatgccagcggggtcgtggagccgcgcgtctgggca
aaggtcacttcgacagtgcgcgagcggatcgtcgagcagtgtaactgcgagggcgaacga
gtggaaaagggtgccgtgctcgcgcgcctggacgatacggaggcgcgggcgattctgagc
gagctgcaggcgcgcctgtcgcttgcccaggaagaataccgccgcaagctcgccttggca
gaaagaaacacgataagcgagcagaccgtggacagggcacgcaccgacgtcgctcaattg
gaggcgttgatcgcgggacaagaggcgcggcttgccgcctacgtgctgcgtgcgcccagt
gacgggcgggtgcttcggcaagacggtgagatcggcgaggtcgccgagcctgggacagtt
ctcttctgggtcggagagccgcgaccgctgatcgtggaggccgaggtgaacgaggaggac
attccgcgggtcgaagtcggccaaaatgcctatcttcggtcggatgcctttccagagcgc
gcgctcgaggcggttgtcgacagcattacgccgaaaggcgatcctgttacgaagacttac
cgcgtccgccttcgcctgcctgaggacacgccgctcagaatcggcatgtcgaccgacgta
aacgtggtggttcgcctgtcgcgcaatgctctggtcatccccgcggcagcggtcagtggg
accagagtcgcggtggttgaagggggaacggcgaaactgcgcgagatcgaaaccggcatc
cgtggcacggacggtgtagaggtcctttccggccttgaagaaaccgcacgcataatctcg
cccttatcccccgattttgccgacgggactcgggtggatgtggtgcaaacagcgacgaat
tga

DBGET integrated database retrieval system