KEGG   Sinorhizobium meliloti BL225C: SinmeB_4307Help
Entry
SinmeB_4307       CDS       T01884                                 

Definition
(GenBank) transcriptional regulator, TetR family
Organism
smq  Sinorhizobium meliloti BL225C
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pSINMEB02:917955..918647
Genome map
AA seq 230 aa AA seqDB search
MPRVKKSPDVRTNELIGCAERLFFEQGYENTTVNDVIREANVSKGAFYHYFVSKEALLEA
VAARMARHSLKELQTVFEDPSLDAVGQLNALFAGSRRLKVEMAPQLKNTFNALFKPENIV
LYHRIDAAVSAVTLPFLTELLRRGHKEGSLDAPDPEALAPMLLYLRLGVAKTMHRALQQT
EAGDLDGAARTLDGWMRTYGMAVERLLKIPEGTIEVTEPGFSRAFLEASV
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgccacgagtgaagaaatcacctgacgtcagaacgaatgagctcatcggttgcgctgaa
cgcctcttcttcgagcagggatacgaaaacacgactgtcaacgacgtgatccgggaggcg
aatgtttccaagggggcgttctatcactacttcgtttcgaaggaggcactgctggaggca
gtcgccgcacgcatggcacgccacagcctaaaggaattgcaaacggtattcgaggatccc
tccctcgatgccgtcggccagctgaatgcccttttcgcgggttcgcggcgcctgaaagtg
gaaatggcgccacagttgaagaatacattcaacgcacttttcaagccggagaacatcgtc
ctttatcatcgcatcgacgcagcggtcagcgcggtgacacttccctttctaaccgaactt
ctgaggcgcggtcacaaggaggggagcctcgacgcgcccgatcctgaagccctcgcgccg
atgctgttgtacttgcgtcttggcgtcgccaagacgatgcatcgggctctgcagcagacc
gaagccggggacctggacggcgcggcgcggacgctggatggctggatgcgcacctacggg
atggctgtcgagagattgctgaagatccctgaagggacgatcgaggtaacggaaccgggt
ttttcgcgcgcatttctggaagcttccgtctag

DBGET integrated database retrieval system