KEGG   Sinorhizobium meliloti BL225C: SinmeB_4311Help
Entry
SinmeB_4311       CDS       T01884                                 

Definition
(GenBank) Fe(3+)-transporting ATPase
  KO
K02010  
iron(III) transport system ATP-binding protein [EC:3.6.3.30]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
ABC transporters
Module
Iron(III) transport system
Brite
KEGG Orthology (KO) [BR:smq00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SinmeB_4311
Enzymes [BR:smq01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.30  Fe3+-transporting ATPase
     SinmeB_4311
Transporters [BR:smq02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter [MD:M00190] [OT]
    SinmeB_4311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pSINMEB02:923753..924814
Genome map
AA seq 353 aa AA seqDB search
MTVVAPGSVVFRNICKQFGAFTAIPDLSLTIEPGTLVTLLGPSGCGKTTTLRMLAGLEHP
TSGRILIGGKDVTMLPANERDVSMVFQSYALFPHMNALDNVAYGLESSGMRRKEARERAE
EGLALVGLPGMGQRLPAELSGGQQQRVAVARALVLEPQVLLLDEPLSNLDARLRRRVRTE
IRELQQRLGFTAVYVTHDQDEALAVSDRIIVMQDGNIAQEGAPRELYETPASAFIADFMG
EANVVACDVINVDGQEATIRVERLTHRVSGRGVRPGPAKLAVRPNAITLEPCAAGSFSGE
ITHTAYLGDHVEYEVKTATGTLFVVDPAVERALAPQTNVAIAFKERGIALING
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcgtggctcccggttccgtcgtctttcggaacatatgcaagcaatttggtgcc
ttcaccgccattcccgacctttcgctgaccatcgaaccaggcacgctcgtcacgttgctc
gggccctccggctgcggcaagacgacgacgcttcggatgctcgccggcctcgaacatccg
acatccggccgcatcctgatcggcggcaaggacgtgacgatgctgcccgcgaacgagcgc
gacgtctcgatggtcttccagtcctatgccctatttccgcacatgaacgccctcgacaac
gtggcctacggcctggagtcgtcaggtatgaggcgcaaggaagcgcgcgaaagagccgag
gaaggactggccctcgtgggcctgcccggcatgggtcagcgcctgcccgccgagctctcc
ggcgggcagcagcagcgcgtcgcggtcgcccgtgcgctggtgctggagccccaggttctt
ctcctcgacgagccgctttcaaatctcgatgcaaggctgaggcgccgcgtccggaccgaa
atccgtgaattgcagcagcggctcggtttcaccgctgtctatgtcacgcacgatcaggac
gaagcccttgccgtctccgaccgcatcatcgtgatgcaggacggaaacatagcccaggag
ggcgccccgcgcgaactgtacgaaacgccggcctccgccttcatcgccgacttcatgggc
gaagccaatgtcgttgcctgcgacgtgatcaacgtcgacggtcaggaggccacgatccgc
gtggaacggctgacgcatcgcgtgagcggtcgcggcgtgcgcccgggaccggcgaagctc
gcggtgcgcccgaacgcgatcacgctggagccgtgcgctgccggcagtttttcaggcgag
atcacccatacggcctatctcggcgaccatgtcgagtacgaggtcaagacggcaacgggg
acgctcttcgtggtcgacccggcggtggagcgggcacttgcgccccaaacgaatgtggca
atcgccttcaaggagcgcggcattgctctcatcaacggttag

DBGET integrated database retrieval system