KEGG   Sinorhizobium meliloti BL225C: SinmeB_4312Help
Entry
SinmeB_4312       CDS       T01884                                 

Definition
(GenBank) inositol monophosphatase
  KO
K01092  
myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
Streptomycin biosynthesis
Inositol phosphate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smq00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    SinmeB_4312
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SinmeB_4312
Enzymes [BR:smq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     SinmeB_4312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pSINMEB02:924845..925645
Genome map
AA seq 266 aa AA seqDB search
MTSHVVPGLEARLALAESIGREAGAMALDFFARRETLIIETKRDPQDLVSIADREVENLI
RDRIAEAYPEDGVLGEEYGLVSGRSGFTWAVDPIDGTSPFVNGMPNWCVSIALVHAGIPV
VGVIAAPCHGELYAAALGLGARLNGKALALDGSRSIRNHVTGLGANNYVKPAFVGRMVEN
LLEAGGTFMRNGSGALMLAYVAAGRLVGYYEPYMHAWDCLAGYCLVQEAGGWYLPFPTEG
ESLTRGSIVLAAAPGAVDDLRKLAGV
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgacatctcacgtcgtccctgggctcgaagcccgcctggcattggccgaatctatcggg
cgcgaggcaggcgcgatggcgctcgattttttcgctcgccgcgaaacgctgatcatcgaa
acgaagcgcgatccgcaggacttggtttccatagccgaccgcgaggtcgaaaatctcatc
cgcgatcgaatcgcggaggcctacccggaagatggcgtgctcggcgaagagtatggcctc
gtttccggccgctcaggcttcacatgggcggttgatccgatcgacggcacgagcccattc
gtcaacggcatgcccaactggtgcgtctccatcgccctcgttcatgccggcataccggtt
gtgggggtcatcgccgccccatgccacggggaactctatgcggcagcgctcgggctcggc
gcacgtctcaacggcaaggcgctcgcactcgacggctcccgctccattcgcaatcacgtg
accggccttggcgccaacaactatgtcaagccggccttcgtcggaaggatggtcgagaac
ctgctggaggcgggcggcaccttcatgcgcaacggttccggcgcacttatgcttgcctat
gtggccgccggccgtctggtgggctattacgaaccctacatgcacgcctgggactgcctc
gccggctattgcctcgtccaggaagcgggcggctggtacctgccctttcccactgaggga
gagagtttgacccgcggctcgatcgtccttgccgccgcgcccggcgcagtcgacgaccta
aggaagcttgcgggcgtctga

DBGET integrated database retrieval system