KEGG   Sinorhizobium meliloti BL225C: SinmeB_4314Help
Entry
SinmeB_4314       CDS       T01884                                 

Definition
(GenBank) hypothetical protein
Organism
smq  Sinorhizobium meliloti BL225C
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pSINMEB02:complement(926655..927440)
Genome map
AA seq 261 aa AA seqDB search
MRIDEAFKALVRIEDGVLMRGAFFAMLAAAGVFLLIDLREISAMNAGLPGFDPMLEDRPV
LPPAVTEAAPNGPPVQPGSSDEVLRQPMRFDLRSGGVLVAEGTLDLGAGSRFADEIEARG
EYVTTVALNSPGGSVDDALAMSKLIREKKLDTKVASKALCASSCPIVFAGGVARVAERDA
LIGVHQVFSGGEERPTPAQAMSFAQSTTARVARHLDSMGVGPGLWINALETPPDRLYYLT
EKEMVDFHLTTEPVATAKTDG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaggatcgatgaagcgttcaaggcgctggtccggattgaggacggtgtgctgatgcgc
ggtgccttcttcgcgatgctggcggccgcgggtgtcttcctgctgatcgacctgcgcgag
atctcggcgatgaacgccggactgcccggtttcgatccgatgctcgaggatcggcccgtc
ctgcctccggcagtgaccgaggctgcgcccaacggcccgccagtccaacccggaagctcc
gacgaagtgctgcgccagccgatgaggttcgatctccgatccggcggcgtactggtcgcc
gagggcacgctcgacctcggcgccggttcgcgcttcgccgacgagatcgaggcgcgcggc
gaatatgtgacgaccgtggctctcaactcgccgggtggttcggtggacgatgcgctcgcg
atgtcgaaactgatccgtgagaagaagctcgacaccaaagtggcatccaaggcgctctgc
gcgtcttcctgcccgatcgtttttgccgggggcgtggcgcgtgtggcggaaagggacgcg
ctgatcggcgtgcaccaggttttcagcggcggcgaggaaaggccgacgccggcacaggcc
atgtccttcgcacaatccaccacggccagagtcgcccgccatctcgattcgatgggcgtc
ggccccggcctctggatcaacgctctcgaaacaccgccggaccggctctattacctgact
gaaaaggagatggttgattttcatctgaccacggagccggtcgctacagccaagacggat
ggctag

DBGET integrated database retrieval system