KEGG   Sinorhizobium meliloti BL225C: SinmeB_4317Help
Entry
SinmeB_4317       CDS       T01884                                 

Definition
(GenBank) response regulator receiver protein
Organism
smq  Sinorhizobium meliloti BL225C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg
Motif
Other DBs
NCBI-ProteinID: AEG08600
JGI: SinmeB_4317
UniProt: A0A0E0UQK2
Position
pSINMEB02:complement(930410..930775)
Genome map
AA seq 121 aa AA seqDB search
MTKILLVEDNEMNRDMLSRRLSRRGFDVLIAENGRAGVELAESQKPDLILMDMSLPVMDG
WEATRRIKANPLTSAIPVIALTAHAMASDREMALEAGCDDYDSKPVDLPQLVRKIEQLLA
I
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaatccttctggtggaagacaatgaaatgaaccgcgacatgctttcgcggcgg
ctgtcccgccggggcttcgacgtgctgattgctgaaaacggaagggccggcgtcgaactt
gccgaatcgcaaaagccggacctgatcctcatggatatgagcctgccggtgatggacggc
tgggaagcgacacgacggatcaaggccaatccgctgacatccgcaataccggtcatcgcc
ctgacggcgcatgcaatggcaagcgaccgggagatggcgcttgaagccggctgcgacgat
tacgacagcaagccggtcgacttgccccagctcgttcgcaagatcgagcagctgctcgcg
atatag

DBGET integrated database retrieval system