KEGG   Sinorhizobium meliloti BL225C: SinmeB_4323Help
Entry
SinmeB_4323       CDS       T01884                                 

Definition
(GenBank) Monosaccharide-transporting ATPase
  KO
K17204  
erythritol transport system ATP-binding protein
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
ABC transporters
Module
Erythritol transport system
Brite
KEGG Orthology (KO) [BR:smq00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SinmeB_4323
Transporters [BR:smq02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Erythritol transporter [MD:M00590] [OT]
    SinmeB_4323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pSINMEB02:complement(938451..939995)
Genome map
AA seq 514 aa AA seqDB search
MHPADDDDCVLRLEDVTKVYSGIIAVRHANLSLRRGAVNVLVGENGAGKSTLMRIIAGVE
KPSLGRILLHGQQVEFHSPADAQRHGIGMVFQELNLFGNLSVAENIFATRELTRGIRGID
HRAQVERATGFLDRLDAGIDAETLVEDLPIGQQQLVEIAKAISLDTRILILDEPTSALSA
AEVDVLFKVIRELKAQGVAIVYISHRLEELMRIGDYITVLRDGQITGHAMVKDIDTKWIV
RSMIGSDAKDFAKSVDHRLGEEAFRAEEICLPRRTGGLAVDHVSISVRAGEVLGIYGLMG
AGRSEFFECVMGQHPHSSGRVFVGGTEVDASDTSGRISAGLALIPEDRQREGLVQALSIA
SNLTLASLDRFVRFGFHIVGAREQASIAAAIRDLSIKAPNPDFEVTSMSGGNQQKVVIGK
ALMTKPKVLLMDEPSRGIDVGAKADVFRTMRRLAGEGLAILFSTSDLEEVMALSDRIAVM
SNGRLVTVIDRADATEEMIIKASAEGHKTTREHA
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgcacccagctgacgacgatgactgcgtcctgcgcctcgaagacgtgacgaaggtctat
tcgggtataattgcggtgcgccatgcgaacctttcgctccggcgcggcgccgtgaatgtg
ctcgtcggggaaaacggtgccggcaagtcgaccctgatgcggatcatcgccggcgtcgag
aagccgtcactcggccgcatcctgctccacggccagcaggtggagttccattcgccggcc
gacgcgcagcgccacggcatcggcatggtcttccaggagctcaatctgttcggcaatctc
tcggttgccgagaacatcttcgcgacgcgggagctgacccggggcattcgcggcatcgat
catcgcgcgcaggtcgagagggctaccgggttcctcgacaggctcgatgccgggatcgat
gccgagacgctcgtcgaagacctgccgatcggccagcagcagctggtggagatcgccaag
gcgatctcgctcgatacccgcatccttattctggacgagccgacatcggccctttcggcg
gcggaggtggacgtccttttcaaggtcatccgggagctgaaggcgcaaggggtggcgatc
gtctacatttctcaccggctcgaggagctgatgcggatcggcgactacatcaccgtgctc
agggatggacagatcaccggccacgccatggtcaaggacatcgataccaagtggatcgtc
cggtcgatgatcggctcggatgcgaaggacttcgccaaatcggtcgaccaccgcctcgga
gaggaggcgttccgcgccgaggagatctgcctgccgcgccggaccggcgggctcgcggtc
gatcatgtctcgatctcggtacgtgccggcgaggtgttgggcatctacgggctgatgggg
gccggccgaagcgaattcttcgaatgcgtcatgggccagcacccgcattcctcggggcgg
gtcttcgtcggcgggacggaggtcgacgccagcgacacgtcgggcaggatcagcgcagga
ttggcgctcataccggaagatcgccagcgcgagggtctcgtccaggcgctttcgatcgcc
agcaacctgacgcttgcgagcctcgaccgcttcgtccgcttcggcttccatattgtcggc
gcgcgggagcaagcctcgatcgcggcggccatccgcgatctttccatcaaggcgcccaac
ccggacttcgaggtgacctcgatgtccggcggcaaccagcagaaggtcgtcatcggcaag
gccctgatgacgaaaccgaaggtgctgctgatggacgaacccagccgcggaatagatgtc
ggcgccaaggcggatgtcttccgcaccatgcgccggcttgccggcgaggggctcgccatc
ctcttttccacctccgacctcgaagaggtcatggcgctctccgaccgcatcgccgtcatg
agcaacggacggctggtcacggtcatcgaccgcgcggacgcgacggaagagatgatcata
aaggcttcggccgagggtcataaaacgacaagggaacacgcctga

DBGET integrated database retrieval system