KEGG   Sinorhizobium meliloti BL225C: SinmeB_4324Help
Entry
SinmeB_4324       CDS       T01884                                 

Definition
(GenBank) periplasmic lipoprotein
Organism
smq  Sinorhizobium meliloti BL225C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pSINMEB02:complement(939998..940642)
Genome map
AA seq 214 aa AA seqDB search
MPKFKVAAALVVAGVMALSGCKIIKTPTAEEAAEAASGGFNPGRMVAEIWDVKVLPYLDR
KAGPFAEVAALAESDPQAAGAKYGHKEKQGSAPWTFAARLSGTVVKAETKSRSAYVEVDA
NGDGKADARVQIGPAIRGTAIRDSLDFVNFNEFKNQIEWAQFGKAFNTHVNGLVLEKLSR
DGLVGKKLDAVGAYPLPAKGQLPLFVPAQLTVGG
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagtttaaggtcgcggccgcacttgtggttgcgggcgtgatggcactctcgggc
tgcaagatcatcaagacgccgactgccgaagaggccgcggaggctgcctccggcggcttc
aaccccggtcgaatggtcgccgagatctgggacgtcaaggtgcttccctatctcgacagg
aaggccggtccgttcgccgaggtggcggctctcgccgagagcgatcctcaggcggcgggt
gccaaatacggccacaaggaaaagcagggaagtgcgccctggacttttgcggcgcgtctt
tccggcaccgtcgttaaggccgagacgaagtcgcgctcggcctatgtggaggtcgacgcc
aacggcgacggcaaggcggatgcgcgcgtgcagattggcccggcgatccgtggcacggcg
atccgcgacagcctcgacttcgtcaacttcaacgaattcaagaaccagatcgaatgggcg
cagttcggcaaggccttcaacacgcatgtcaacggactggttctggaaaagctgtcccgc
gacgggcttgtcggcaagaaactcgacgcagtcggcgcctatccgctgcccgccaagggt
caattgccgctgttcgttccggctcagctgacggtgggcggatga

DBGET integrated database retrieval system