KEGG   Sinorhizobium meliloti BL225C: SinmeB_4334Help
Entry
SinmeB_4334       CDS       T01884                                 

Definition
(GenBank) hypothetical protein
Organism
smq  Sinorhizobium meliloti BL225C
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEG08617
JGI: SinmeB_4334
UniProt: A0A0E0UPM9
Position
pSINMEB02:complement(952473..952670)
Genome map
AA seq 65 aa AA seqDB search
MSTSKKTPASIRQGGPGASHENAKEPLEIPKPPADSERRTRSKVSGGGGEPDRHHSHDAR
RKGGH
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
atgtccacatccaagaagacgccagcaagcatccgccagggcggtccgggagcctcgcac
gaaaatgcaaaggagccgctggaaataccaaagccgccagccgactccgagcgccgcacg
cgcagcaaggtttccggcggcggaggcgagcctgaccgccaccacagtcacgacgcgagg
cgcaagggcgggcattga

DBGET integrated database retrieval system