KEGG   Sinorhizobium meliloti BL225C: SinmeB_4343Help
Entry
SinmeB_4343       CDS       T01884                                 

Definition
(GenBank) choline/carnitine/betaine transporter
  KO
K02168  
choline/glycine/proline betaine transport protein
Organism
smq  Sinorhizobium meliloti BL225C
Brite
Transporters [BR:smq02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   SinmeB_4343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pSINMEB02:959504..961483
Genome map
AA seq 659 aa AA seqDB search
MHRFKVNLPVFVGSVAVIALFVGIGVIAPKRAELIFSGMQTAILSGFGWLYLLSVAIFLF
SMLFLAFSRYGELKLGPDDSEPEFRYLSWIAMLFAAGMGIGLMYFAVGEPMTHFASPPEA
EPLTIAAQREAMSVTFFHWGVHAWAIYSVVGLSLAYFGYRYNLPLTVRSGLYPLLKEGIH
GPIGHVVDIFAICGTMFGLATSLGFGVLQINSGLNYLLGVPQSIYVQLLLVTVVTAIATV
SVVTGVEKGVRILSETNLFLAVLLMLFVLVVGPTGTLMRDFVQNIGLYLDSLVLRTFNIY
AYEPRPWIDSWTLFYWAWWISWSPFVGMFIARISRGRTVREFVTAVLFVPAMFTFLWMTV
FGNTAIYVDTTIANGELARDVKADLSVALFQFFEYLPWPAVTSTLAVLLVSIFFVTSSDS
GSLVIDTIASGGETATPALQRIFWCSLSGIVAAVLLSTGGLTALQSATISTALPFSLVML
ILVWSLFVGMRADLARTQSPGSVGPRAYPASGVPWQRRLAMTLSTPDRRAVEKFLQASVL
PALEAVARELTRRSRPASVGRDAETGALTLTVPAEGHRDFVYGVQMSEHKLPAFTAYDAT
VADVRYEARTFFSDGSRGYDIMGMADNQIINDVLFQFERYTGFVRSPESSLLATSPEER
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccgtttcaaagtgaatttgccggtattcgtcggttcggtggccgtcatcgctctg
ttcgtcgggataggtgtgattgcgccaaagagagctgaattgattttcagcggaatgcag
actgcgatcctgtccgggttcggttggctctacctgctctcggtggccatctttctgttt
tcgatgctatttctggcgttcagccgctacggcgagttgaagctcggaccggacgattca
gaacccgagttcaggtacctgtcctggatcgccatgctgtttgccgccggcatgggcatt
ggcctcatgtattttgccgtcggcgagccgatgacgcattttgcctcgccgccggaagcc
gaacccctgaccatcgcggcccagcgcgaggcaatgagcgtaaccttcttccattggggg
gtgcacgcctgggcgatatactcggtcgtcgggctgtcactcgcctatttcggctaccgc
tacaatctacccctgaccgtccgatccggcctctacccgctcctcaaggagggcattcac
gggccgatcggacatgtcgtggatatattcgcgatctgcgggaccatgttcgggctcgca
acctcgctcggattcggcgtccttcagataaactccggactgaactatctgttgggggtc
ccccagtcgatctacgtccagctcctgctcgtgaccgtggtcacggcaatagcgactgtc
tcggtggtcaccggcgtcgaaaagggtgtccgcattctcagcgagaccaatctgttcctg
gcagtactgctgatgctcttcgtgctcgtggtcgggccgacgggcacgctcatgcgcgac
ttcgtccagaacatcggtctctatctcgatagcctggttttgcgaaccttcaacatctat
gcctacgagccacggccgtggatcgacagctggaccctgttctactgggcatggtggatt
tcctggtcacccttcgtcggcatgttcatcgcgcgcatttcccgtgggcgtaccgtgaga
gagttcgtcaccgccgtcctcttcgtacccgccatgttcactttcctctggatgaccgtt
tttggaaacacggcgatctacgtggacacgacgatcgccaacggcgaactggcgcgtgac
gtgaaggcggacctttcggtcgcccttttccagttcttcgagtatctgccgtggcccgcg
gtaacctcgacgctcgcggttctgctcgtcagcatattcttcgtaacctccagcgactcc
ggctcgctggtgatcgacacgattgcatccggcggagaaacggcgacacctgctcttcag
cggattttctggtgttcgctcagcggtatcgttgcggccgttctgctctccaccggcgga
ctgacggcactccaatccgccacgatctcgacggcactgccgttcagcctcgtgatgctc
attctggtgtggtcgctattcgtcggaatgcgggccgatcttgcccgcacacaatcaccc
gggtcggtcggtccaagagcctatcccgcgtccggtgtgccctggcagcggcgcctggcg
atgaccttgagcacgccggataggcgggcggtggagaaattcctgcaggcttccgttctt
ccggcattggaggcagtggcaagggaactgacgcgccggtctcggccggcttcagtcggt
cgggatgccgaaacgggagcactgaccctcactgttccggccgaaggccatcgcgatttc
gtctatggcgtgcagatgtcggaacacaaacttcccgccttcaccgcgtatgacgcaacc
gtggcagatgtccgttacgaggcgcgcaccttcttttcggacggtagccgcggctatgac
atcatgggaatggcggacaaccagatcatcaacgatgttctgtttcagttcgaacgatac
acgggcttcgtacggtccccggagtcctcgctgttggcgacctcgcccgaagagcgatag

DBGET integrated database retrieval system