KEGG   Sinorhizobium meliloti BL225C: SinmeB_4344Help
Entry
SinmeB_4344       CDS       T01884                                 

Definition
(GenBank) sulfatase
  KO
K01130  arylsulfatase [EC:3.1.6.1]
Organism
smq  Sinorhizobium meliloti BL225C
Pathway
smq00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:smq00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SinmeB_4344
Enzymes [BR:smq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.6  Sulfuric-ester hydrolases
    3.1.6.1  arylsulfatase
     SinmeB_4344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sulfatase Sulfatase_C TAT_signal
Motif
Other DBs
NCBI-ProteinID: AEG08626
JGI: SinmeB_4344
UniProt: A0A0E0UPR8
Position
pSINMEB02:complement(961627..962868)
Genome map
AA seq 413 aa AA seqDB search
MGLPHAEKRNNAQESISIDRRSLLLGGTTLAAAAAANGPVGSAKAQEQPAASTGKPPNVL
VIFGDDIGIPQISAYTMGLMGYRTPNIDRIAAEGAIFTDAYGQQSCTAGRASFILGQEPF
RTGLLTIGMPGDPHGIQDWMPTIADVMKSKGYATGQFGKNHLGDRDEHLPTNHGFDEFFG
NLYHLNAEEEPEGYFYPKDEEFRKNFGPHGVIKSSADGKIEDTGGLNTKRMETVDASSLL
PRRISSNAKRRPTSRSSGDKNFKVHLDGYDFTELKGEAKEPPREAVYYFDQGGNLNAIRW
NDWKLSFAINSEGNIATATRETPSWANITNLRMDPYERGAKEGGGAMEFIGRSMWLLVPI
QGKIREFFQDFDQYPYQPGSTLNASGISYTWLQQQAALKRLGELGELESLAPR
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgggccttccacatgctgaaaagcgcaacaatgcgcaagaatccatctccatagatcgt
cggagcctccttctgggaggtacgacccttgcagcggcggctgcggcgaacgggcccgtg
ggcagcgcgaaggctcaggagcaaccggcggcaagcaccggcaagccgccgaacgtcctc
gtcatcttcggcgacgacataggcattccacaaatcagcgcctacaccatgggcctgatg
ggttatcgtacaccgaacatcgatcgtattgccgccgagggtgcgatcttcaccgatgcc
tatgggcagcagagctgcaccgcagggcgcgcttccttcattctcggccaggaaccgttt
cgcacggggctgctgacgatcggcatgcccggcgacccacacggcattcaggactggatg
ccgaccatcgccgacgtcatgaagtccaagggatacgcaaccggtcagttcggcaagaat
cacctgggcgaccgcgacgagcatctgccgacaaaccacggcttcgacgaattcttcggc
aacctctaccacctgaatgccgaagaggagccggaaggctacttctatccgaaggacgag
gaattccggaaaaacttcgggccgcacggtgtcatcaaatcgagcgcggatggaaagatc
gaggataccggagggctcaacacaaagcgcatggagaccgtcgacgcgagttccttgctg
ccgcgaaggatttcatcgaacgccaaacgaaggccgacaagccgttcttccggcgacaag
aacttcaaggtccatctcgacggctacgacttcaccgaactgaagggcgaggccaaggaa
ccgccccgcgaagcggtctactatttcgaccagggcggcaatctgaatgcgatccggtgg
aacgactggaagctcagctttgcaatcaacagtgaaggcaacatcgccacggccacccgc
gagacgccgagctgggccaacatcacaaatctgagaatggatccctatgagcgaggtgcg
aaagaaggcggaggagccatggagttcattggccgaagcatgtggctcctggtgccgatc
cagggcaagatcagggagttcttccaggacttcgaccagtatccctaccagcctggcagc
actctgaacgccagcgggatcagctatacgtggctgcaacagcaggccgcgctcaagcgg
ctcggagagttgggagagttggaaagcctggcgccgcgttga

DBGET integrated database retrieval system