KEGG   Sinorhizobium meliloti BL225C: SinmeB_4352Help
Entry
SinmeB_4352       CDS       T01884                                 

Definition
(GenBank) transcriptional regulator, LacI family
  KO
K02529  
LacI family transcriptional regulator
Organism
smq  Sinorhizobium meliloti BL225C
Brite
Transcription factors [BR:smq03000]
 Prokaryotic Type
  Helix-turn-helix
   LacI family
    SinmeB_4352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
pSINMEB02:970602..971618
Genome map
AA seq 338 aa AA seqDB search
MKLKEFAKQLGLSPTTVSRALSGYPEVSEKTRKRVAEEAVRLGYRPNINAVRLVTGRAGA
IGVVMGRNEFQFSEFMSGMAERLDSEDIDILVSPVADHDMKAELQLYSRLATSGRVDAVI
IHSPKPNDERILLLHKLGIPFLVHGRSETNVPHAWLDIDNEGAIRRATSHLLDLGHRRIA
LINGRDGLTFTLHRDKGYREALEQRGLPFDPRLVTHGQFTDEIGFRSARSFLEQSPRPTA
FVAGSMMTALGVYRAVRSVGLVVGKDISVIAHDDVFPYLTADNMVPSLSTSRSSLRAAGA
RSADLTLQLLTGRPATEIHELWPVELILRESTGPAPEA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtgaagctcaaggaattcgccaaacagttggggctctctccaacgacggtaagccgtgct
ctgagcggctatccggaggtcagcgagaagacgcgcaagcgggttgccgaagaggccgtg
cgcctcggttaccgcccgaacatcaacgccgtgcgcctggtcacgggccgcgcaggcgcg
atcggcgtcgttatgggtcgcaacgaattccagttctccgaattcatgagcggcatggcc
gaacggctggacagcgaggatatcgacattctcgtgagcccggttgccgaccatgatatg
aaagccgagctccagctctatagccggctggcgacgagcggacgggtcgacgccgtaatc
atccattcaccgaagccgaacgacgagcgcatcctgctgctccacaagctcggcattccc
tttctggtccatggccgctccgagaccaacgtgccgcacgcctggctcgacatcgacaac
gaaggcgcgatccgccgcgccacctcgcaccttctagacctcggccatagacggatcgca
ctcatcaacggccgcgacggtctcactttcacgctccaccgcgacaagggctatcgcgag
gcgctggaacagcgtgggctgcccttcgatccgcgcctcgtcacgcatggccagttcacc
gacgagatcggttttcgctcggcccgttccttcctcgagcagtccccccgcccgacggcc
ttcgtcgccggctcaatgatgacggcgctcggcgtctatcgcgccgtgcgttcggtcggc
cttgtggtcggaaaggacatctccgtcatcgcacatgacgatgtctttccctatctcacg
gccgacaacatggtcccgtccctttcgacgagccggtcgtccctgcgcgccgccggcgcg
cgctcggccgacctcaccctgcaactgcttaccggacggccggccacggaaattcacgag
ctctggccggtcgagctcatcctgcgcgagtcgaccggtccggcgcctgaagcttga

DBGET integrated database retrieval system